Details for Lyrate rockcress Locus 16046603

Position : sca3 ( 5`- 1932869 .. 1934151 -3` )
Annotation : [B2G] signal peptidase subunit family protein
External links : CoGe
PGDD synteny : 16046603

Protein [Map View]
MHTFGYRANALLTFAVTALAFICAIASFSDKFSNQNPSAEIQILNINRFKKQSHGNDEVSLTLDISADLQSLFTWNTKQV
FVFVAAEYETPKNSLNQVSLWDAIIPAKEHAKFRIQVSNKYRFIDQGQNLRGKEFNLTLHWHVMPKTGKMFADKIVMPGY
SLPDAYR*

DNA
ATGCATACTTTTGGTTACAGAGCAAATGCTCTGCTCACTTTCGCAGTCACTGCGCTTGCATTCATTTGCGCAATCGCTTC
TTTCTCGGACAAATTCAGCAACCAAAATCCCTCTGCTGAGATCCAGATACTTAATATTAATCGGTTTAAGAAGCAATCTC
ATGGAAATGATGAGGTCAGCTTGACATTGGATATATCAGCAGACTTGCAGTCACTATTTACTTGGAACACCAAACAGGTT
TTTGTTTTCGTAGCAGCGGAGTATGAAACCCCGAAGAATTCCCTGAATCAGGTTTCTTTATGGGATGCGATTATCCCTGC
CAAGGAACATGCCAAATTCCGGATTCAAGTCTCAAACAAGTATCGTTTCATCGATCAGGGACAGAATCTTCGGGGAAAAG
AATTCAACTTGACATTACACTGGCATGTCATGCCCAAGACCGGGAAGATGTTTGCTGACAAGATAGTCATGCCTGGTTAC
AGTTTACCAGATGCATACAGATGA