Details for Lyrate rockcress Locus 16046573

Position : sca1 ( 5`- 7678017 .. 7678553 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046573

Protein [Map View]
MGNTSSCAPLIISTNSSSGVVKILAPFTGTLEVFPKPIKTSDIVSRRSGHFITDSTLLQIGQRVTAVSPNEFLRPRRHLY
LLLPTDMLFSVLTHEELALISDKAAETLNESRYSHLKRIFPVCIFPATGDKRRNSSSANDDDNHDHDGVEIRETLDEKVL
YESKHGSWRPKLETIVES*

DNA
ATGGGAAACACATCTTCATGCGCACCGTTGATCATATCAACAAACTCATCCTCAGGAGTAGTCAAAATCTTGGCTCCATT
CACCGGAACTCTCGAAGTTTTCCCAAAACCCATCAAAACCTCCGACATCGTCTCTAGACGCTCCGGCCACTTTATCACCG
ACTCAACTTTACTCCAAATCGGCCAACGAGTCACCGCCGTATCTCCCAACGAGTTTTTACGGCCGAGACGACATCTCTAC
CTCCTCCTCCCGACCGACATGCTCTTCTCTGTCTTAACACATGAAGAACTCGCTCTCATCTCCGACAAAGCCGCGGAGAC
ACTCAACGAAAGCCGGTATAGCCATTTGAAGAGAATATTCCCTGTTTGCATATTTCCGGCGACGGGAGACAAAAGAAGAA
ACTCATCATCAGCTAATGATGATGATAATCATGATCACGATGGTGTGGAAATAAGAGAAACCCTAGATGAGAAGGTACTA
TACGAATCAAAACATGGATCTTGGAGGCCTAAGTTGGAGACGATCGTGGAGAGCTAA