Details for Lyrate rockcress Locus 16046376

Position : sca3 ( 5`- 2993056 .. 2994138 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478032 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16046376

Protein [Map View]
MSALKSRSNSLAGLSLDAVLGGEIVIQPSSPPSPPPLPSKSLVPHRATSQTLFDIIREEYAKEGHKDRTTWQIFREKLRL
KRTGSAWTSSLHIPASDILIPNPKHLGTAFRSHSAGLNIRDLVHAIPMSDPPGSSGRAMFTRGSSMRVGSSKNPDDSPDI
SVLGDGPPSRSFKPQLSRHDSVRDHSDGEEDNRRRHPIVTFVEERQMSAREAVAAQEAAEAEAAAAGGSEDEDDDDEEDD
SGETEERKSSSGSEPKQTMSLMDLLEETDRQMGLTGSRYAMDEDEEYEEDEEDENYEEEGDGQGGGEGELSCCVCMVKIK
GASFTPCGHTFCKLCSKELMAQKGHCPVCSSFVLEFLEIF*

DNA
ATGTCGGCGTTAAAGAGCCGTAGTAACTCGTTAGCTGGACTAAGTCTAGACGCTGTGCTTGGCGGCGAGATCGTTATACA
ACCGTCATCTCCCCCATCGCCACCACCTTTACCATCAAAATCTCTTGTACCGCACCGCGCAACAAGCCAAACGCTTTTTG
ATATCATACGTGAGGAATACGCCAAAGAAGGGCACAAAGATCGTACCACGTGGCAGATTTTCCGTGAGAAACTCCGTCTC
AAACGAACCGGTTCTGCTTGGACCTCGTCTCTTCATATCCCTGCTTCGGATATTCTTATCCCTAATCCCAAACACCTTGG
AACAGCGTTCCGATCACACTCCGCCGGTTTAAACATCCGAGATCTGGTTCACGCTATACCGATGTCTGATCCACCTGGTT
CTTCAGGACGCGCTATGTTCACACGCGGATCATCAATGCGGGTCGGGTCGAGCAAAAACCCGGACGATTCGCCTGACATC
AGCGTTCTTGGAGATGGACCACCGTCTAGGAGTTTTAAGCCGCAGTTATCACGGCACGATTCCGTTAGAGATCACAGTGA
CGGCGAAGAAGATAACAGACGACGTCATCCGATCGTCACGTTCGTGGAAGAGAGGCAAATGTCGGCGAGAGAAGCGGTTG
CTGCTCAAGAAGCGGCGGAAGCTGAAGCGGCGGCGGCTGGAGGAAGCGAAGACGAAGATGACGATGACGAAGAGGATGAT
TCAGGAGAAACAGAGGAGAGAAAATCATCTTCAGGTTCTGAACCGAAACAGACGATGTCTCTGATGGATCTGTTGGAAGA
AACAGATCGACAAATGGGATTAACAGGATCGAGATACGCCATGGATGAAGATGAAGAGTACGAAGAAGACGAAGAAGATG
AGAATTACGAAGAAGAAGGAGATGGTCAAGGAGGAGGAGAAGGTGAGCTTAGTTGCTGCGTTTGCATGGTGAAAATCAAA
GGCGCTTCTTTTACACCTTGTGGTCACACGTTTTGTAAGCTCTGTTCTAAAGAGCTTATGGCTCAGAAAGGTCACTGTCC
TGTTTGCAGCAGCTTCGTCCTCGAGTTCCTTGAGATCTTTTAG