Details for Lyrate rockcress Locus 16046346

Position : sca3 ( 5`- 4692096 .. 4692851 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046346

Protein [Map View]
MNTTLRYDPRQISRQTKPSDTPSSSPSRSHRRQPLLQRSLSSPSPRASCGGSTPAEFCGGTTASCAAVWCCCPCGLVNLL
VLAIYKVPKGICRRAIRNRRRKQLVKNGILPPLPTDGKNERMQRVFQNSEFAIHPLDSDDVSDDEDDDNFLDLKYIGKSV
AAAGFTTEEETDEDDEAVLALEKEMWNRFYGAGFWRSPSQRESVSSPRVSKSLSSSPRPSFTEVYRNRDTTVKGGGATVV
AATPRAVRHFD*

DNA
ATGAACACGACTTTACGTTACGATCCAAGACAGATCTCGAGGCAAACGAAACCGTCTGATACTCCATCGTCTTCTCCGTC
TCGTAGTCACCGGAGACAGCCTTTGCTTCAGAGAAGTCTCTCTTCTCCCTCACCAAGAGCTTCTTGCGGCGGATCTACTC
CCGCCGAGTTTTGTGGTGGTACGACGGCGAGTTGCGCCGCCGTTTGGTGTTGTTGTCCTTGCGGACTCGTTAACCTCCTC
GTTCTCGCGATCTATAAAGTTCCTAAAGGAATCTGCCGTCGCGCTATCCGTAATCGCCGCCGTAAACAACTCGTGAAGAA
CGGAATCCTTCCGCCGCTTCCGACGGACGGGAAAAACGAGCGGATGCAGAGAGTTTTTCAGAATTCTGAATTCGCGATTC
ATCCGTTGGATAGCGACGATGTCTCGGACGACGAGGATGATGATAATTTCTTGGATCTGAAGTATATCGGAAAATCGGTA
GCGGCGGCGGGGTTTACGACTGAGGAGGAGACTGATGAAGACGACGAGGCGGTGTTAGCATTAGAGAAAGAGATGTGGAA
TAGATTTTACGGCGCCGGGTTTTGGCGAAGTCCGTCACAGAGAGAATCGGTTTCGTCTCCGAGAGTTTCCAAGTCTCTTT
CGTCATCGCCGAGACCGTCGTTTACTGAAGTGTACCGGAATAGGGACACAACGGTTAAAGGCGGAGGAGCTACGGTGGTG
GCGGCCACACCAAGAGCCGTTAGGCATTTTGATTAG