Details for Lyrate rockcress Locus 16046340

Position : sca3 ( 5`- 13010877 .. 13012911 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_899194 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16046340

Protein [Map View]
MGLHVLRPPIALRSSLLGFLSKSHNPLLSGRWVRAGDCSTMRCFASATRGKNKKQRLDEACVERFNEYSRTLIQSWIIQG
KVLVDGRRVIKAGMPVSNTAAIKITAEVPKFVCRGGLKLEAALEKLDVDVSEKVVLDSGLSTGGFTDCLLRYGAAHVYGV
DVGYGQVADKIRNDKRVTVIERTNLRYLPGLPQKVDVVTLDLSFISILKVMPAIMNVMKEDATLVTLVKPQFEARRQQVG
KGGIVRDPEVHQEVLEKIINGVERYGFTNKGFIESPIKGAEGNIEFLVCFNRGTVKPEGEEY*

DNA
ATGGGACTTCATGTTCTTAGACCTCCCATAGCTTTACGAAGCTCTCTCCTCGGCTTCTTATCCAAATCTCACAATCCTCT
TCTCTCCGGGAGATGGGTTAGAGCCGGAGATTGCAGTACTATGAGATGTTTTGCTTCTGCTACTCGTGGGAAAAACAAAA
AACAGAGACTAGATGAGGCATGTGTTGAAAGGTTTAACGAATACAGTCGCACACTAATACAATCATGGATTATACAAGGA
AAAGTTCTTGTGGATGGGAGAAGAGTTATTAAAGCTGGAATGCCTGTATCTAATACTGCAGCTATAAAGATTACAGCTGA
GGTTCCAAAATTTGTATGTAGAGGTGGACTCAAGCTGGAAGCTGCACTTGAGAAGCTAGATGTTGATGTTTCTGAGAAAG
TAGTTCTTGATTCAGGACTTTCTACAGGAGGGTTTACGGATTGTTTGCTTCGTTATGGTGCAGCTCATGTTTATGGCGTA
GATGTTGGTTACGGTCAGGTAGCTGATAAAATCCGCAATGATAAGCGGGTGACTGTTATAGAAAGAACAAATCTGAGATA
CCTCCCTGGACTCCCACAAAAAGTCGATGTAGTGACTCTTGACCTCTCGTTCATTTCTATTCTAAAGGTGATGCCAGCTA
TTATGAATGTGATGAAAGAAGATGCAACTTTAGTTACTCTTGTTAAACCCCAATTTGAAGCTCGAAGACAACAGGTCGGG
AAGGGTGGCATAGTGAGAGATCCCGAAGTACATCAGGAGGTTCTTGAGAAGATAATAAATGGTGTTGAGCGCTATGGATT
TACTAACAAAGGCTTTATCGAATCTCCCATAAAGGGCGCCGAGGGAAACATAGAGTTCTTGGTTTGCTTCAACCGAGGGA
CAGTAAAACCCGAAGGAGAAGAATACTAG