Details for Lyrate rockcress Locus 16046325

Position : sca3 ( 5`- 7422881 .. 7421195 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_898077 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16046325

Protein [Map View]
MATETSTQSYSEKWYWDERYTNESEPFDWYQKYSSLAPLINLYVPHRNQRALVIGCGNSAFSEGMVDDGYEDVVNIDISS
VVIDTMIKKYSDRPQLKYLKMDVRDMKAFEDASFDAVIDKGTLDSILCGSNSRQYSTQMLEEVWRVLKDKGVYILITYGA
PIYRLRLFKESCSWTTKLHVIDKSLTDQPLETPKWELTKPLPLDAEGSSVESAIGKSPDVHYIYVCIKDESLKMDADAA*

DNA
ATGGCTACAGAGACATCGACGCAATCTTACAGTGAGAAATGGTATTGGGACGAGCGTTACACGAACGAATCTGAACCGTT
TGATTGGTACCAGAAGTATTCATCTTTAGCTCCTCTCATTAATCTCTATGTTCCTCACCGTAATCAACGAGCCCTCGTCA
TTGGCTGTGGAAACTCAGCGTTTAGCGAAGGAATGGTGGATGATGGATATGAAGATGTAGTCAATATTGATATATCATCA
GTGGTGATTGATACCATGATTAAGAAATACTCTGATCGTCCTCAGCTCAAATATTTGAAGATGGATGTGCGTGATATGAA
GGCATTTGAAGATGCTTCTTTTGATGCTGTTATCGATAAAGGAACCTTAGACTCTATTTTGTGTGGGAGCAATTCCAGGC
AATACTCAACACAAATGCTTGAAGAGGTTTGGAGGGTCCTCAAGGATAAAGGAGTCTATATCCTGATTACATATGGAGCT
CCGATTTACCGTCTTCGCCTGTTTAAAGAATCATGCTCTTGGACAACGAAACTCCATGTTATAGACAAAAGTTTAACTGA
TCAACCGTTAGAAACCCCAAAATGGGAGCTGACAAAACCACTTCCTCTAGATGCTGAGGGAAGTTCAGTGGAATCTGCGA
TAGGCAAAAGCCCTGATGTCCATTACATCTATGTCTGCATTAAGGATGAGTCGTTGAAGATGGATGCAGACGCAGCATGA