Details for Lyrate rockcress Locus 16046314

Position : sca3 ( 5`- 4628853 .. 4629636 -3` )
Annotation : [B2G] integral membrane family protein
External links : CoGe
PGDD synteny : 16046314

Protein [Map View]
MKNESTTIDVPAESSSAMKGKAPLIGVARDHTTSGSGGYNRGLSIFDFLLRLAAIVAALAAAATMGTSDETLPFFTQFLQ
FEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTILRPLATAPRLLLLVLDTAVLALNTAAASSAAAISYLAHSGNQNT
NWLPICQQFGDFCQKSSGAVVSAFISVVFFTILVVISGVALKRH*

DNA
ATGAAAAACGAATCTACCACCATTGATGTCCCTGCAGAATCCAGCTCAGCTATGAAAGGCAAAGCTCCTCTAATCGGTGT
GGCTAGAGACCATACCACTAGTGGCTCAGGTGGATACAACAGAGGTCTCTCCATCTTCGACTTCCTCCTCCGTCTAGCTG
CCATTGTTGCAGCTTTAGCCGCTGCTGCAACTATGGGAACAAGCGACGAGACTCTTCCATTCTTCACACAGTTCTTACAG
TTCGAAGCTAGCTACGATGATCTACCAACTTTCCAGTTCTTTGTGATTGCCATGGCCCTAGTAGGAGGATATCTCGTTCT
GTCTCTCCCAATCTCCGTCGTGACAATCCTTCGCCCTCTCGCCACCGCCCCAAGATTACTCTTGCTCGTTCTTGACACTG
CGGTTCTGGCTTTGAACACGGCGGCTGCATCATCGGCAGCAGCAATATCGTATCTAGCGCACAGTGGAAACCAGAACACG
AACTGGCTCCCCATTTGCCAACAGTTTGGGGACTTCTGTCAGAAATCCAGTGGAGCTGTTGTCTCTGCCTTTATCTCCGT
CGTATTCTTCACCATCCTCGTTGTCATCTCCGGCGTCGCTCTAAAAAGACACTAA