Details for Lyrate rockcress Locus 16046305

Position : sca3 ( 5`- 8061376 .. 8060118 -3` )
Annotation : [B2G] ribosomal protein s6 family protein
External links : CoGe
PGDD synteny : 16046305

Protein [Map View]
MPLYDCMLLFKPIIRKEGLIDLVARIGKHVYSRNGVLTEIKSFGKVELGYGIRKLDGRHYQGQLMQITMMTTPNMNKELH
YLNKEDKLLRWLLVKHRDIKIGQLEKEVSLTEPNRLTTESLYDNSSSDEDDDNILGLSR*

DNA
ATGCCGCTCTACGACTGTATGCTTTTGTTCAAGCCAATAATCAGGAAGGAAGGCCTCATCGATCTCGTTGCGCGCATCGG
GAAACACGTTTATAGCAGAAATGGCGTCCTCACCGAGATCAAATCCTTTGGCAAGGTCGAATTGGGTTACGGCATTAGAA
AGCTCGACGGAAGACACTACCAGGGGCAATTGATGCAGATAACAATGATGACAACTCCAAACATGAACAAGGAGCTTCAC
TACCTCAACAAGGAAGACAAACTGCTGCGCTGGCTCCTAGTTAAACACCGCGACATCAAGATTGGACAATTGGAAAAGGA
AGTTAGTCTGACCGAGCCTAACAGACTTACTACTGAGAGCTTATATGATAATTCCTCCTCGGACGAAGATGACGACAACA
TTCTAGGGTTATCACGATGA