Details for Lyrate rockcress Locus 16046287

Position : sca3 ( 5`- 7945060 .. 7948957 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479356 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16046287

Protein [Map View]
MVVETLERSCEGSKRRHVNGGDVAVPCSGDEFSNGDINAAPVVSAKRARVSREMTFQDIYGADALLNDDDDEEDDCDWEP
VQAPVEFVNWCCVNCTMSNPGDMVHCYICGEHKESGILRHGYLASPFFKDTGLIEVEEKYGGSSSATSSTAVGFDERMLL
HSEFEVKPHPHPERPDRLRAIAASLATAGVFPGRCLPINAREITKQELQMVHTSEHVDAVNTTSQLLYSYFTSDTYANEY
SARAARLAAGLCADLATEIFTGRVKNGFALVRPPGHHAGIRHAMGFCLHNNAAVAALVAQAAGAKKVLIVDWDVHHGNGT
QEIFEQNKSVLYISLHRHEGGHFYPGTGAADEVGTNGGEGYCVNVPWSCGGVGDKDYIFAFQHVVLPIASAFSPDFVIIS
AGFDAARGDPLGCCDVTPAGYSRMTQMLGDLCGGKMLVILEGGYNLRSISSSATAVIKVLLGEIPENNLPIAATPSREGL
QTVLDVMNIQMKFWPSLAISYSKLLSEWEARLIENKKNQMKRKLVRVPTWWKWGRKKLLYKFLSGRMISRSK*

DNA
ATGGTTGTAGAAACTCTTGAGAGGTCCTGTGAGGGTTCAAAGAGAAGACATGTGAATGGTGGTGATGTCGCTGTTCCTTG
TTCGGGCGATGAGTTTAGCAATGGAGATATTAATGCAGCTCCTGTAGTTTCAGCAAAAAGAGCTAGGGTTTCTAGAGAAA
TGACGTTTCAAGATATTTACGGTGCTGATGCATTACTGAATGATGATGATGATGAGGAGGATGATTGTGATTGGGAACCT
GTGCAGGCGCCTGTGGAGTTTGTAAACTGGTGTTGTGTTAATTGTACTATGTCGAACCCTGGTGATATGGTCCACTGTTA
TATATGCGGTGAACACAAGGAATCTGGCATCCTGAGGCATGGATATTTAGCGTCTCCCTTTTTTAAAGACACTGGTCTCA
TTGAAGTCGAAGAGAAATATGGAGGAAGCTCATCTGCAACCAGCTCAACAGCTGTTGGGTTCGACGAGAGAATGTTGCTA
CACTCAGAATTTGAAGTGAAGCCACATCCACATCCAGAGAGACCTGATCGTCTTCGAGCTATAGCTGCTAGTCTTGCCAC
AGCTGGTGTTTTTCCTGGAAGATGCTTGCCTATTAATGCAAGGGAAATCACGAAACAAGAACTCCAGATGGTCCACACTT
CAGAGCATGTTGATGCTGTTAATACTACAAGCCAGCTTCTCTATAGCTACTTCACCTCTGACACGTATGCTAATGAGTAT
TCAGCACGTGCTGCTAGACTTGCAGCAGGTTTGTGCGCTGATCTAGCAACAGAAATTTTCACTGGCCGTGTAAAAAATGG
TTTCGCTTTGGTTAGACCTCCGGGTCATCATGCTGGCATCAGGCATGCTATGGGGTTTTGCCTTCACAATAATGCAGCCG
TTGCTGCATTAGTAGCACAAGCAGCAGGGGCAAAGAAGGTGCTGATTGTGGACTGGGATGTACATCATGGAAATGGAACT
CAAGAGATATTCGAACAAAACAAATCTGTATTGTACATATCCTTGCACAGACATGAGGGAGGACACTTCTATCCCGGTAC
TGGAGCTGCTGATGAGGTTGGTACAAATGGTGGGGAAGGTTATTGTGTAAATGTTCCTTGGAGTTGCGGTGGAGTTGGTG
ATAAAGACTATATCTTTGCATTTCAACATGTGGTTCTTCCCATAGCTTCTGCATTTTCTCCAGATTTTGTCATCATATCA
GCGGGATTTGATGCTGCTAGAGGAGACCCATTAGGATGCTGTGATGTGACTCCGGCTGGCTATTCTCGAATGACACAGAT
GTTGGGTGATCTGTGCGGTGGGAAAATGCTAGTTATTCTGGAGGGGGGCTACAATCTTCGCTCCATATCTTCTTCTGCAA
CAGCAGTGATCAAGGTGCTTCTGGGTGAAATTCCGGAGAATAACCTGCCCATCGCAGCCACGCCTTCAAGAGAAGGCCTA
CAAACTGTTCTTGATGTAATGAATATTCAAATGAAGTTCTGGCCATCACTTGCTATCAGCTACTCCAAATTACTCTCAGA
GTGGGAAGCACGTCTGATCGAAAACAAAAAAAATCAGATGAAAAGGAAGCTTGTTCGGGTTCCGACATGGTGGAAATGGG
GACGAAAGAAGCTTTTGTACAAGTTTCTCTCAGGGCGTATGATTTCAAGATCAAAATGA