Details for Lyrate rockcress Locus 16046275

Position : sca3 ( 5`- 4894931 .. 4893780 -3` )
Annotation : [B2G] fatty acid desaturase
External links : CoGe
PGDD synteny : 16046275

Protein [Map View]
MGAGGRMPVPTSSKKSETDTIKRVPCEKPPFSVGDLKKAIPQHCFKRSIPRSFSYLIGDIIIASCFYYVATNYFSLLPQP
LSYLAWPLYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSNTGSLERDEVFVPK
QKSAIKWYGKYLNNPLGRIMMLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIYLSDAGILAVCFGLY
RYAAAQGMASMICLYGVPLLIVNAFLVLITYLQHTHPSLPHYDSSEWDWLRGALATVDRDYGILNKVFHNITDTHVAHHL
FSTMPHYNAMEATKAIKPILGDYYQFDGTPWYVAMYREAKECIYVEPDREGDKKGVYWYNNKL*

DNA
ATGGGTGCAGGTGGAAGAATGCCGGTTCCTACTTCTTCCAAGAAATCGGAAACCGACACCATAAAGCGTGTGCCGTGCGA
GAAACCGCCTTTCTCGGTGGGAGATCTGAAGAAAGCAATCCCCCAGCATTGTTTCAAACGCTCAATCCCTCGCTCTTTCT
CCTACCTTATCGGTGACATCATAATTGCCTCATGCTTCTACTACGTTGCCACCAATTACTTCTCTCTCCTACCTCAGCCT
CTCTCTTACTTGGCTTGGCCACTCTATTGGGCCTGTCAAGGCTGTGTCCTAACTGGTGTCTGGGTCATAGCCCACGAATG
CGGTCACCACGCATTCAGCGACTACCAATGGCTGGATGACACAGTCGGTCTTATCTTCCATTCCTTCCTCCTCGTCCCTT
ACTTCTCCTGGAAGTATAGTCATCGCCGTCACCATTCCAACACGGGATCCCTCGAAAGAGATGAAGTATTTGTCCCAAAA
CAGAAATCCGCAATCAAGTGGTACGGCAAATACCTCAACAACCCTCTTGGACGCATCATGATGTTAACCGTCCAGTTTGT
CCTCGGGTGGCCCTTGTACTTAGCCTTTAACGTTTCGGGCAGACCGTATGACGGGTTCGCTTGCCATTTCTTCCCCAACG
CTCCCATCTACAATGACCGCGAACGCCTCCAGATATACCTCTCGGATGCGGGTATTCTAGCCGTCTGTTTTGGTCTTTAC
CGTTACGCCGCTGCACAAGGAATGGCCTCTATGATCTGCCTCTACGGAGTACCGCTTCTGATAGTGAATGCGTTCCTCGT
CTTGATCACTTACTTGCAGCACACTCACCCCTCCTTGCCTCACTACGATTCATCAGAGTGGGACTGGCTCAGGGGAGCTT
TGGCTACCGTAGACAGAGACTATGGAATCTTGAACAAGGTGTTCCACAACATTACAGACACACACGTGGCACATCACCTG
TTCTCGACAATGCCGCATTATAACGCAATGGAAGCTACAAAGGCGATAAAGCCAATACTGGGAGACTATTACCAGTTCGA
TGGAACACCGTGGTATGTGGCGATGTATAGGGAGGCAAAGGAGTGTATCTACGTAGAACCGGACAGGGAAGGTGACAAGA
AAGGTGTTTACTGGTACAACAATAAGTTATGA