Details for Lyrate rockcress Locus 16046229

Position : sca3 ( 5`- 2338538 .. 2337969 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046229

Protein [Map View]
MSKRRICCIVSAIIIVLFAIFMAALILAQVFKPKHPILQTVSSTVDGISTNISLPYEVQLNFTLTLQMLLKNPNVADFEY
KTVENLVYYRDTLVGNLTLPSSTLPAKGSVLLACPLFLQLDKFVANLGDIVQDVLHGKIVMETKARMPGKITLLGIFKIH
LDSISHCNLVLGFPSMEVVDQVCDLSTKL*

DNA
ATGTCCAAACGACGCATTTGCTGCATAGTTTCCGCAATCATTATTGTCCTCTTCGCCATCTTCATGGCCGCTTTGATCCT
TGCGCAAGTGTTCAAACCAAAACATCCCATTCTACAAACCGTCTCTTCAACTGTTGATGGCATATCTACAAATATATCAC
TACCATATGAGGTCCAACTAAATTTCACTCTTACACTTCAGATGCTGCTCAAGAATCCTAACGTTGCGGATTTTGAATAC
AAGACAGTGGAAAACTTGGTTTATTACAGGGATACACTAGTGGGAAATCTCACTCTTCCTTCGAGCACATTACCTGCCAA
AGGCTCAGTGCTTTTGGCATGTCCTCTTTTTCTTCAGCTCGATAAATTTGTCGCGAATTTAGGTGATATCGTGCAAGATG
TATTGCATGGAAAAATTGTGATGGAGACAAAGGCAAGAATGCCAGGAAAAATCACGTTGTTGGGAATCTTTAAGATTCAT
TTGGATTCAATATCGCATTGCAACCTCGTACTTGGCTTTCCTTCGATGGAAGTGGTGGATCAAGTGTGTGATCTCAGCAC
TAAGCTGTAA