Details for Lyrate rockcress Locus 16046216

Position : sca3 ( 5`- 5958799 .. 5958153 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046216

Protein [Map View]
MAYSTKLCLPLKTPCFVPKTVRSKTWMLQQSQVHVNVKQVTVSQPQPIRYSTKNTVFEDPTQGIICYTDDNGEVICEGYD
EGPRCPTQSPMVASYSREVEILDLLQRSYQELSNSKKDGQRQILASQQEFTMIKWSSFDFL*

DNA
ATGGCATATTCAACCAAACTTTGCCTTCCTCTTAAAACGCCATGTTTTGTTCCAAAGACAGTAAGATCAAAGACTTGGAT
GCTTCAACAAAGTCAAGTTCATGTTAATGTCAAGCAAGTCACAGTTTCACAGCCTCAGCCGATCAGATACTCCACCAAGA
ACACTGTTTTTGAAGATCCGACACAAGGGATTATCTGTTACACAGATGATAATGGAGAGGTTATATGTGAAGGATACGAT
GAAGGTCCTCGTTGTCCCACACAGAGTCCAATGGTAGCTTCTTACTCAAGAGAGGTGGAGATTCTTGATCTTCTGCAAAG
AAGTTATCAGGAGCTGAGTAATTCAAAGAAGGATGGTCAAAGACAGATACTTGCTTCACAACAAGAGTTCACGATGATCA
AATGGAGCAGCTTTGACTTCCTCTAA