Details for Lyrate rockcress Locus 16046205

Position : sca3 ( 5`- 8138314 .. 8136317 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046205

Protein [Map View]
MEFVAEEGKLVNEDCSTLVLPALSIGNVGQLAVDLLVSSTGTERVGYLDDPYLLPCVGNDAYGPLPCGDIALPLEVYESS
SIATTLAQQRSPVAKGMMIKFAENIADFAASSGKKHVIVLSSLDFQRLHNLDMSRGPQVYYLSNAESDGRDDHCERLGFG
RLREYDSEGRCWKYLSSVFEKNSEEELTFPSEDELEDIDYYPSLPFAALFSAYKARGLKVTCLLCYCSEGDNIPEAFLLA
EAASKLTGLTPDKFHGEEGGKWRIPYSWKSMYGAPPDMSMF*

DNA
ATGGAGTTTGTTGCTGAAGAAGGAAAGCTAGTGAATGAAGATTGCTCGACTTTAGTTCTCCCTGCATTGTCAATTGGGAA
TGTGGGGCAGCTAGCTGTTGATCTTCTAGTGTCATCTACCGGTACAGAGAGAGTTGGTTATCTCGATGATCCATATCTGC
TTCCTTGTGTTGGAAATGACGCTTATGGCCCTCTTCCTTGTGGCGATATCGCCCTTCCTCTTGAGGTTTATGAGTCATCT
TCAATTGCTACTACTCTTGCTCAGCAACGGTCTCCAGTTGCAAAGGGAATGATGATTAAATTTGCGGAGAATATAGCCGA
TTTTGCTGCTTCAAGTGGAAAGAAGCACGTTATTGTGTTATCGAGTTTAGACTTTCAAAGGCTGCATAACTTGGATATGT
CGAGAGGCCCACAGGTGTATTATCTGTCTAACGCCGAATCTGATGGAAGAGATGATCACTGTGAAAGGCTTGGATTTGGA
AGATTGCGCGAGTATGATTCAGAAGGAAGATGTTGGAAGTACCTTAGCTCTGTCTTTGAGAAGAACAGTGAAGAAGAGCT
GACTTTCCCTTCAGAAGATGAACTTGAAGACATAGACTACTATCCAAGCTTGCCATTTGCAGCTCTGTTCTCAGCTTATA
AGGCAAGAGGCTTGAAGGTGACATGCCTGCTATGTTACTGTTCTGAAGGAGACAACATTCCTGAAGCATTTCTTCTAGCC
GAGGCTGCATCTAAGCTTACGGGTCTGACTCCTGATAAGTTCCACGGGGAAGAAGGTGGGAAATGGCGGATACCGTATTC
GTGGAAGAGTATGTATGGAGCTCCTCCAGATATGTCCATGTTTTAA