Details for Lyrate rockcress Locus 16046135

Position : sca3 ( 5`- 1598015 .. 1600355 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046135

Protein [Map View]
MATSLMSLSSSFLQPLKLKTLSKPRNTDLSTTRKIITTCDSQKNTGKSNPSSRNPNFQKRRNSSKYGTSRRSILKKSFLQ
EQVTFTARISDDPHVAIIGGGMAGLVCALNLEARGVQSTVFDTGIHGLGGRLGTRIIEPQGLIFDHAAQFFTADDSRFIK
LVDGWLEKGLVREWKGAVGELEVGGSFSQFPSSSPPRYIAVNGMLSLADSLLLESQMVNLVRPCWISKLEPLNGMWHLSE
NGTPRGQFDVIVIAHNGKCANRLLSASGLPLVAKQMKKLDLSSIWALLAAFDDPLPTVNFEGAFVKGVESLSWMGNNSAK
LGNGRNPHCWTFFSTAAYGKQNKVPQENIPTVTAEKVRAGMLQGVEIALGLPEGSLPKPVYTRLQLWGAALPKNTPAVPC
IFDPQGRAGICGDWLLGSNLESAALSGAALGNHIAEFLQNGEANPEEFAIGLHDRLSPLDGHDIGQFPGLTSVGEKEEAN
AYQVL*

DNA
ATGGCCACTTCTTTAATGTCTCTGTCTTCTTCCTTTCTTCAACCTCTGAAACTCAAAACCCTATCAAAACCCAGAAACAC
TGACTTATCTACCACCAGAAAGATTATAACAACATGCGATTCACAAAAGAACACTGGGAAGTCAAACCCCAGCAGCAGAA
ACCCTAATTTCCAGAAACGGCGAAACTCCTCCAAGTATGGGACTTCTAGAAGGTCGATCCTCAAGAAATCGTTTTTACAA
GAGCAAGTTACTTTCACCGCACGAATCTCTGATGACCCCCACGTGGCGATTATCGGTGGAGGAATGGCGGGTTTGGTCTG
CGCATTGAACCTGGAAGCTCGTGGCGTCCAATCCACAGTTTTCGATACGGGGATACATGGGTTAGGAGGAAGACTTGGAA
CAAGGATTATTGAACCACAGGGGCTTATTTTCGATCACGCTGCTCAATTCTTCACTGCGGATGATTCTCGGTTTATCAAA
TTGGTAGATGGGTGGTTAGAGAAAGGACTTGTTCGAGAGTGGAAAGGTGCTGTGGGAGAGCTTGAAGTTGGAGGTAGCTT
CTCACAGTTTCCCTCATCATCACCTCCAAGATACATTGCTGTTAATGGCATGCTATCTCTCGCTGATTCATTGCTATTAG
AGAGTCAAATGGTGAATCTGGTAAGGCCTTGTTGGATCAGTAAGTTGGAACCACTTAATGGGATGTGGCATTTAAGTGAG
AATGGAACACCTCGTGGTCAGTTTGATGTCATTGTCATTGCTCATAATGGTAAATGCGCAAATCGCTTGCTTTCAGCATC
AGGCTTGCCCCTAGTGGCTAAACAGATGAAGAAACTGGATTTGAGTTCAATATGGGCTCTATTAGCAGCTTTTGATGATC
CTCTTCCTACAGTGAACTTTGAGGGAGCGTTTGTGAAAGGAGTTGAATCATTGTCTTGGATGGGAAATAACTCTGCAAAG
CTTGGAAATGGCAGAAATCCACATTGCTGGACATTTTTCAGTACTGCAGCATATGGGAAACAGAACAAAGTTCCTCAGGA
AAATATCCCAACGGTCACGGCAGAGAAAGTTAGAGCTGGGATGCTTCAAGGTGTGGAAATCGCATTGGGGTTGCCTGAAG
GCTCGCTTCCTAAACCCGTTTACACACGTCTCCAGCTATGGGGAGCAGCTTTGCCGAAGAACACTCCTGCAGTTCCATGT
ATATTTGATCCACAAGGCCGTGCTGGTATATGCGGTGATTGGCTTCTCGGTTCTAACTTAGAATCTGCAGCTTTAAGCGG
TGCAGCCTTAGGAAACCATATTGCAGAATTCCTGCAGAACGGTGAAGCTAACCCAGAAGAGTTTGCAATCGGTTTACATG
ATAGGTTAAGTCCTCTTGATGGCCATGATATTGGCCAGTTTCCTGGTTTAACTTCAGTGGGAGAAAAGGAAGAAGCGAAT
GCATATCAAGTACTGTGA