Details for Lyrate rockcress Locus 16046115

Position : sca2 ( 5`- 16587451 .. 16587841 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046115

Protein [Map View]
MGKRRFQKAKEPSVAEVSSPTESQTTRRRRGRPRKNLENPEDFKKEESEEDEDYEEYEDEEEEDEEAEVINREKQKKKVR
SSSSMEEEQKMKHEELEEEEEKPEMKMKVVVPPPSSRRSRRKSTPV

DNA
ATGGGAAAGAGAAGATTTCAGAAAGCAAAGGAACCGTCAGTCGCAGAAGTTTCATCTCCGACGGAGTCTCAGACTACAAG
GAGACGAAGAGGAAGGCCAAGGAAGAATCTTGAGAACCCCGAAGATTTCAAGAAGGAAGAATCTGAAGAAGACGAGGATT
ACGAAGAGTACGAGGACGAAGAAGAAGAAGACGAAGAAGCTGAGGTTATTAACAGAGAGAAGCAGAAGAAGAAAGTTAGG
AGTAGTAGTAGTATGGAAGAGGAGCAAAAGATGAAACATGAAGAGTTAGAGGAGGAGGAGGAGAAGCCGGAGATGAAGAT
GAAGGTGGTGGTTCCACCGCCGTCGTCTAGACGGTCGAGGAGGAAAAGTACGCCGGTGA