Details for Lyrate rockcress Locus 16046112

Position : sca3 ( 5`- 11449369 .. 11449812 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046112

Protein [Map View]
MNTPKTIILLLLMLIAISLTIIFTLILQPQTMFLGEEFDVRVINSFRDNSSLPLVIWCTSPQGDLGGRALQEGDDFEWTA
KIDLWSWMAEYTCTMKWNSKRKRFEAFKVSRDSNRCGSTKKCSWSVREDGFYFSSDEVYWTKDFSWL*

DNA
ATGAACACTCCAAAAACAATCATTCTTCTTCTGCTTATGCTTATCGCCATCTCCTTAACGATCATCTTCACGTTGATACT
TCAACCACAAACTATGTTTCTAGGAGAAGAATTCGACGTGCGTGTGATCAACAGCTTCAGAGACAACTCTTCTCTCCCTC
TAGTGATTTGGTGCACTTCCCCGCAAGGAGATCTCGGTGGTCGTGCGCTTCAAGAAGGAGACGACTTCGAATGGACGGCC
AAGATCGATTTGTGGTCGTGGATGGCAGAGTACACATGTACAATGAAATGGAATTCGAAGAGGAAGAGGTTCGAGGCGTT
TAAGGTTTCTAGAGACAGCAATAGATGTGGATCTACTAAGAAGTGTTCTTGGTCCGTTAGAGAAGATGGATTTTATTTTA
GTAGTGATGAGGTTTATTGGACCAAAGATTTTTCTTGGTTATAA