Details for Lyrate rockcress Locus 16046078

Position : sca3 ( 5`- 3548683 .. 3551500 -3` )
Annotation : [B2G] dnaj heat shock n-terminal domain-containing protein
External links : CoGe
PGDD synteny : 16046078

Protein [Map View]
MVRTRLAISVVLVSTLLLLNVESKSVDPYKVLGVSRDAKQREIQKAFHKLSLKYHPDKNKNKGAQEKFAEINNAYEILSD
EEKRKNYDLYGDEKGQPGFDSGFPGGNGGYSYSSNGGHGGGGFNFGGPGGWQNMGGGGGSKSFSFSFGGPSESSFGFGMD
DIFSMFSGGSSKGKEQFGGFGSSSKAESKSKSSTVVPIRTINSQVYKKEILDQGMTWLVLSYLPSQRGTQYHESIIEEVA
ESLQGALKVGRINCETESSLCKQLGIVPRRAPRLFVYSYTSSGKATLAEYTEELVAKKVKSFCQEHLPRFSKRIDLNTFD
VSAVSSQRTPKVMLLSTKKDTPVIWRVLSGLYNGRFVFYNTEVHDTSDPKIQKLGVDAFPAIVGWLSNGEKQVLKTGITV
KNLKSAVQELGKLLEGFEKKNKKVSSNSQPGQSPSESLETIPLLLRSNFDSICGENTPVCIIGAFRSSHGKEKLQSVMSK
VSQKSLSRRQASTTGSQDTVSYSLLDATKQSAFLSSLDKSEFKTSDKFLIAYKPRRGKFATFKGDMTMEEVEKFVAAVLN
GDIQFTKTRQKPQIK*

DNA
ATGGTGAGAACAAGATTGGCGATTTCTGTTGTTCTTGTGTCCACATTGTTGTTGTTGAATGTGGAGTCGAAGAGCGTTGA
TCCTTATAAGGTTCTTGGAGTATCTCGGGATGCAAAGCAGCGTGAAATTCAGAAAGCTTTTCACAAGCTATCTCTGAAAT
ATCATCCAGATAAAAACAAAAACAAGGGTGCTCAGGAGAAGTTTGCTGAGATTAATAATGCTTATGAGATCTTATCTGAT
GAAGAGAAGAGGAAAAATTATGATCTTTATGGAGATGAGAAAGGACAGCCAGGATTTGACTCGGGTTTTCCCGGAGGTAA
TGGTGGTTATTCATACTCCTCAAATGGTGGACATGGTGGTGGTGGTTTCAATTTTGGAGGGCCAGGTGGATGGCAAAATA
TGGGCGGTGGGGGAGGCTCTAAATCGTTTTCTTTCTCGTTTGGCGGTCCTAGTGAAAGCTCCTTTGGTTTTGGGATGGAT
GATATCTTTTCCATGTTTTCGGGCGGTAGTTCTAAAGGAAAGGAGCAGTTTGGTGGCTTTGGTAGCTCATCAAAGGCTGA
ATCTAAATCAAAGAGCAGTACGGTAGTACCTATCAGAACCATAAATTCTCAGGTCTATAAGAAGGAAATTTTGGACCAAG
GGATGACTTGGCTTGTGTTGTCGTATCTTCCATCTCAAAGGGGAACCCAGTACCATGAATCGATCATAGAGGAAGTTGCT
GAGTCGTTGCAAGGAGCTTTAAAGGTTGGGCGTATAAATTGTGAAACAGAATCCTCTCTTTGCAAACAACTAGGCATAGT
TCCTCGTAGGGCTCCAAGGTTGTTTGTTTATTCATACACGTCAAGTGGCAAAGCTACCTTAGCAGAATATACTGAAGAGC
TTGTTGCAAAAAAGGTGAAAAGTTTCTGCCAGGAACATCTACCGAGATTCTCAAAAAGAATTGATCTGAATACATTCGAT
GTTTCTGCTGTTAGCTCACAAAGGACTCCTAAAGTTATGCTTCTGTCAACAAAGAAAGACACTCCTGTTATCTGGCGTGT
TCTGAGTGGCTTGTACAATGGACGCTTTGTCTTTTACAACACAGAGGTCCATGATACTTCTGATCCAAAGATACAAAAGT
TGGGGGTTGACGCGTTTCCGGCAATAGTTGGCTGGTTATCGAATGGGGAGAAGCAAGTCTTGAAAACAGGTATCACTGTG
AAAAATCTGAAATCAGCTGTCCAGGAACTTGGTAAATTACTTGAAGGATTTGAGAAAAAGAACAAGAAGGTCTCTTCTAA
TAGTCAGCCGGGCCAATCACCTAGCGAGTCCTTGGAAACGATACCTCTTCTTTTGAGGTCAAATTTTGATTCTATTTGTG
GGGAGAACACTCCTGTTTGTATCATCGGTGCCTTCAGATCTTCACATGGTAAAGAGAAGTTGCAGTCAGTAATGTCCAAG
GTATCCCAGAAATCACTCTCTCGACGACAAGCTTCAACCACAGGTTCTCAGGACACAGTATCCTATTCGCTTCTAGACGC
AACAAAACAATCTGCGTTCTTGAGCTCCCTTGACAAATCAGAGTTCAAAACTTCTGATAAGTTCCTAATAGCTTACAAGC
CTCGACGAGGTAAGTTTGCTACATTTAAAGGCGATATGACTATGGAGGAAGTTGAGAAATTCGTAGCAGCTGTTCTTAAC
GGAGACATACAGTTCACGAAGACAAGACAGAAACCTCAGATCAAATGA