Details for Lyrate rockcress Locus 16046077

Position : sca3 ( 5`- 4880773 .. 4884902 -3` )
Annotation : [B2G] EMB2738 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16046077

Protein [Map View]
MASLLDSLTTRCFFTIPSISRISSPLASSSSLTSSPSSSSPIIPSFSVLSYTHQHSHSRFPFLVAATLDGSSAEEELDFE
EFDQYAEDNYADDSDDEDDSIDISVLEKEARDIVRDYATILSRELKLEDETIEGKETRRKGKRLAKNTQQIPEHLLQRVA
IVGRPNVGKSALFNRLVGENRAIVVDEPGVTRDRLYGRSYWGDQEFVVVDTGGVMTVSKSPSGVMEELNVSTTIGMEGIP
LSSREAAIARMPSMIEKQATAAVDESAVIIFVVDGQAGSSGADVEIADWLRKYYSHKYIILAVNKCESPRKGLMQASEFW
SLGFTPIPISALSGTGTGELLDLVCSGLNKIEIMENIEEEEEENYIPAIAIIGRPNVGKSSILNALVREDRTIVSPVSGT
TRDAIDAEFTGPDGEKFRLIDTAGIRKKSSVASSGSTTEAMSVNRAFRAIRRSDVVALVIEAMACITEQDLKIAERIERE
GKGCLVVVNKWDTIPNKNQETAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTAILNQVIR
EAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLRTDAGFAGTPIRLLWRSRKRSDKNGG
GGGTMRMAGLTRQRNLATKRT*

DNA
ATGGCGAGTCTACTTGATTCGTTGACAACCAGATGCTTCTTCACCATTCCTTCAATTTCTAGGATTTCTTCTCCTTTAGC
TTCTTCATCTTCATTGACTTCTTCACCATCTTCCTCTTCTCCAATTATCCCATCTTTCTCAGTTCTCTCTTACACTCACC
AACACTCGCATTCTCGCTTCCCTTTCCTTGTTGCAGCAACTCTGGATGGTTCCTCTGCTGAAGAAGAGCTAGATTTCGAA
GAATTCGACCAATATGCTGAAGACAACTACGCTGATGATTCGGATGACGAAGACGACTCCATCGATATCTCCGTTCTTGA
GAAAGAAGCGAGAGATATCGTGAGAGATTATGCTACCATTTTGTCTCGCGAGCTCAAACTCGAGGATGAGACCATTGAGG
GGAAGGAAACTCGTAGAAAAGGGAAAAGGCTAGCCAAAAATACGCAGCAGATACCAGAGCATCTTCTCCAAAGAGTTGCG
ATCGTTGGAAGGCCAAATGTTGGCAAATCAGCATTGTTCAACCGTCTTGTTGGGGAGAATAGAGCTATTGTAGTGGATGA
ACCAGGAGTTACTAGGGATCGATTGTACGGTAGATCGTATTGGGGTGATCAAGAATTTGTGGTGGTAGACACAGGAGGTG
TTATGACTGTTTCAAAGTCACCATCTGGTGTCATGGAAGAGCTGAATGTATCAACCACCATTGGGATGGAAGGTATTCCA
CTAAGCTCTAGGGAAGCAGCTATTGCAAGGATGCCTTCCATGATTGAGAAACAAGCTACAGCAGCTGTCGATGAATCAGC
TGTCATTATTTTCGTTGTCGATGGCCAGGCAGGGTCATCAGGTGCTGATGTGGAAATTGCGGACTGGTTGCGGAAGTACT
ACTCACATAAGTATATCATTCTCGCGGTAAACAAATGTGAATCACCACGTAAAGGACTCATGCAGGCTTCGGAATTTTGG
TCTCTAGGGTTCACACCTATCCCTATTTCTGCATTGTCGGGAACTGGAACAGGAGAGCTGCTTGATCTTGTTTGTTCTGG
GCTAAATAAAATCGAGATCATGGAGAACATCGAAGAGGAGGAAGAAGAAAACTACATTCCTGCCATTGCAATTATTGGTC
GGCCAAATGTTGGCAAAAGTAGCATTTTAAATGCACTTGTCCGAGAGGATAGAACAATAGTTAGCCCTGTTAGTGGAACT
ACCCGTGATGCTATAGATGCAGAATTTACCGGACCAGATGGGGAGAAGTTTCGGCTTATAGATACAGCTGGGATCAGGAA
AAAGTCATCTGTGGCTTCATCAGGCAGCACTACAGAGGCCATGTCAGTGAATCGTGCATTTCGAGCAATTCGTCGTTCTG
ATGTTGTTGCCCTTGTCATTGAAGCCATGGCATGCATAACAGAGCAGGATCTGAAGATTGCAGAAAGAATAGAAAGAGAA
GGGAAAGGATGTCTGGTTGTTGTAAACAAATGGGATACAATACCAAACAAAAACCAAGAGACTGCAGCACATTACGAGGA
CGATGTTCGGGAGAAGCTCCGTTCCCTCAAATGGGCACCTATTGTTTATTCTACCGCAATAACTGGCCATAGTGTTGACA
ATATTGTGGTTGCTGCTGCGACGGTTCAAAAGGAGAGGTCAAGAAGACTTAGTACAGCCATATTGAACCAAGTGATAAGA
GAAGCAGTTGCATTTAAATCTCCTCCAAGAACCCGTGGAGGCAAGCGAGGCCGCGTTTACTATTGCACCCAGGCAGCAAT
AAGGCCACCGACGTTTGTTTTCTTTGTAAACGACGCAAAGCTGTTTTCGGATACGTACAGAAGGTATATGGAGAAGCAGC
TACGCACTGATGCAGGCTTTGCTGGGACTCCAATTCGGCTACTTTGGCGCAGCCGTAAAAGATCTGACAAAAATGGAGGA
GGTGGAGGAACAATGAGAATGGCAGGTCTTACACGCCAGAGAAATCTTGCAACCAAAAGAACATAA