Details for Lyrate rockcress Locus 16046031

Position : sca3 ( 5`- 2454794 .. 2453004 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046031

Protein [Map View]
MPEKGMILPPVPSQLVLLRPSPLLQWRLGALTALVFFLMLVVWSIDGCSIQSFVEPWRFNAYSVRISPSPSPLMSPKPNL
VSEKPHRQNLTLKTTMVPRNLVPKKTNLTSNLTRVQFGWIAAELQKNFTANLMRNWLAPGGEPCREAKTVEISVAGVDGN
DSVELTAGEIHEFKIQAIDESGKHVCIGGDYFETDLSGENWKSRPPVKDFGNGTYSFSLQVHPEFAGDYNFTVILLFRHY
QGLKFSTSRLGFDRKLRNVKLRFVKKPDVTLPELRSCKKSDFNRAAWSGRWTRLGKNDECQISNDGRYRCLAADFPCRKP
WCDGAVGAIESNGWVYSSHCSFKLFSGEKAWDCLKDKWIFFWGDSNHVDSIRNLLNFVLGHPEIPAVPRRFDMKFSNPKN
PLETVRITSIFNGHWNETKNYQGLDSLKDRDFRELLKKYFTEETNRVPDVMIVNSGLHDGIHWTSLRAFAKGAETAAAFW
RDIFDGVKSRGLQPPEVIFRNTIATGGYARTLAFNPSKMEAFNGVFLEKMRDAGLVTSVVDNFDMTYPWHYDNRCNDGVH
YGRAPAKMRWRDGEIGHQYFVDLMLVHVLLNALCVR*

DNA
ATGCCGGAGAAAGGAATGATTTTGCCTCCGGTACCGAGCCAATTGGTGCTTTTACGGCCAAGCCCTCTGCTTCAATGGCG
GCTTGGTGCTCTTACTGCACTCGTCTTCTTCCTCATGTTAGTCGTTTGGAGTATTGACGGTTGTTCGATTCAAAGCTTCG
TTGAGCCATGGAGATTCAATGCATACTCTGTTCGAATCAGTCCTTCTCCGTCGCCTTTAATGTCACCGAAACCCAATCTA
GTATCAGAGAAACCTCACCGCCAAAATCTCACTTTGAAGACGACGATGGTTCCACGAAATCTGGTTCCGAAGAAGACGAA
TCTCACTTCAAACTTGACCCGGGTCCAATTCGGGTGGATTGCCGCCGAATTGCAGAAGAATTTCACGGCGAATTTGATGA
GAAATTGGCTGGCTCCGGGAGGAGAGCCGTGCAGAGAAGCGAAAACCGTCGAGATTTCAGTTGCCGGCGTCGACGGGAAT
GATTCGGTGGAGTTAACCGCCGGTGAGATTCATGAATTCAAAATTCAAGCCATAGATGAATCTGGAAAACACGTTTGCAT
TGGTGGGGACTATTTCGAGACTGATTTATCCGGCGAGAATTGGAAATCGAGGCCGCCGGTGAAAGATTTCGGTAACGGAA
CTTACTCTTTCTCGTTACAGGTTCATCCTGAGTTCGCCGGAGATTACAATTTCACCGTCATTTTGCTCTTCCGTCACTAC
CAAGGTCTTAAGTTCAGTACCTCACGTTTAGGCTTTGACCGAAAGCTTCGCAATGTTAAATTACGTTTCGTCAAGAAGCC
TGACGTTACTCTGCCGGAGCTCCGGTCATGTAAAAAATCTGATTTTAACAGAGCTGCTTGGTCCGGACGGTGGACTAGGC
TTGGCAAGAATGATGAGTGTCAGATTAGCAATGACGGCCGTTACCGCTGCCTTGCTGCGGATTTTCCTTGCCGGAAACCG
TGGTGCGACGGAGCGGTTGGAGCGATAGAGAGCAATGGGTGGGTTTACTCGAGTCATTGCTCCTTCAAGCTCTTCTCTGG
TGAAAAGGCTTGGGATTGCTTGAAAGACAAATGGATTTTCTTCTGGGGAGATTCGAATCATGTTGATTCGATCAGAAACT
TGCTGAATTTCGTCTTGGGTCATCCGGAAATCCCCGCTGTCCCGAGGAGATTCGATATGAAGTTTTCGAATCCGAAGAAC
CCATTGGAGACTGTTAGGATCACGAGTATTTTTAACGGTCATTGGAACGAGACCAAGAACTACCAGGGCCTCGATTCACT
CAAAGACAGGGACTTTAGAGAATTGCTCAAGAAATACTTCACGGAAGAAACAAACCGTGTTCCCGACGTGATGATCGTGA
ACTCGGGTCTACACGACGGGATTCACTGGACTAGTCTTAGAGCCTTTGCGAAAGGCGCAGAAACTGCAGCTGCATTTTGG
AGAGATATATTTGATGGGGTCAAAAGCAGGGGATTGCAACCGCCAGAAGTGATTTTCAGGAACACAATCGCGACAGGCGG
TTACGCGAGAACGCTAGCTTTTAACCCGAGTAAAATGGAGGCGTTTAACGGAGTGTTTCTCGAGAAAATGAGGGACGCAG
GATTGGTCACAAGCGTAGTTGATAACTTCGATATGACGTATCCGTGGCATTATGATAACAGGTGCAACGATGGAGTTCAT
TACGGAAGAGCTCCTGCGAAAATGCGGTGGAGGGACGGTGAGATCGGACATCAGTACTTTGTGGATTTGATGCTCGTTCA
CGTATTGCTGAATGCATTGTGTGTAAGATAG