Details for Lyrate rockcress Locus 16046012

Position : sca3 ( 5`- 3088333 .. 3086762 -3` )
Annotation : [B2G] glycosyl hydrolase family 17 protein
External links : CoGe
PGDD synteny : 16046012

Protein [Map View]
MRLLHLLALSLLISVSGAKFSGRPGVNYGQLGNNLPSPADSVNLIKSLNAKRVKLYDANPKILTALNGTDITVSVMVPNE
LIVNISKSESLSDDWIRSNILPFYPTTKIRYLLVGNEILSFPDSELKSSLVPAMRKIQRSLKSLGVKKVKVGTTLAVDVL
QSSFPPSSGEFRSDISGLVMKPMLQFLNRTKSFLFVDVYPYFAWAQDPTHVDLDYAIFESSNVTVTDPVTNLTYHNLFDQ
MIDAFVFAMKRLGYPDLRIWVAETGWPNNGDYDQIGANIYNAATYNRNVVKKLAADPPVGTPARPGKVLPAFVFALYNEN
QKTGPGTERHFGLLHPNGTQVYGIDLSGKTTEYKESLPAPENNEFYKGKIWCVVAKGANWTQLGDALSYACSQGNNTCDP
IQRGGPCHKPDLTVLHASYAFSSYWAQFRKTGGTCSFNGLATQTIKDPSYGRCEFPSVTL*

DNA
ATGAGACTTCTACATCTTCTTGCTCTGTCTCTGCTAATCTCTGTTTCAGGAGCAAAGTTCTCCGGCCGGCCAGGAGTCAA
CTACGGCCAGCTCGGAAACAACCTCCCATCTCCGGCCGACTCAGTCAACCTCATAAAATCCCTAAACGCAAAACGAGTCA
AACTCTACGACGCTAACCCAAAAATCCTCACCGCCTTAAACGGCACCGACATTACCGTCTCCGTCATGGTCCCAAACGAG
CTAATCGTCAACATCTCCAAATCCGAATCACTCTCCGACGACTGGATCCGATCCAACATCCTCCCGTTTTACCCAACCAC
CAAGATCCGTTACCTCCTCGTCGGCAACGAGATCCTCTCTTTTCCAGACTCTGAGCTCAAATCTTCACTCGTTCCCGCAA
TGCGCAAGATCCAACGGTCCTTAAAGTCTCTCGGCGTTAAGAAAGTCAAAGTAGGGACTACACTCGCCGTCGACGTTCTC
CAATCTTCGTTTCCTCCGTCTAGCGGCGAGTTTCGGTCGGATATCTCCGGTTTAGTTATGAAACCGATGCTCCAATTCTT
AAACCGGACCAAATCTTTCTTATTCGTTGATGTTTACCCGTATTTCGCGTGGGCTCAAGATCCGACCCATGTGGATCTCG
ATTACGCCATTTTCGAATCTTCCAACGTCACCGTCACGGATCCAGTCACGAATCTGACCTACCACAACCTGTTCGATCAG
ATGATTGACGCTTTCGTCTTCGCTATGAAACGACTCGGGTATCCGGATCTTCGGATCTGGGTCGCGGAAACGGGTTGGCC
CAATAACGGTGACTACGACCAAATTGGAGCGAATATTTACAACGCCGCCACTTACAATCGCAATGTTGTCAAGAAACTCG
CCGCTGACCCGCCCGTAGGTACGCCCGCCCGACCCGGAAAGGTTCTACCGGCGTTTGTATTCGCGCTTTACAACGAGAAT
CAGAAAACGGGTCCGGGTACGGAGCGGCATTTCGGACTTTTACATCCCAACGGGACTCAGGTCTACGGGATTGATTTGTC
GGGGAAGACGACGGAGTACAAGGAATCGTTGCCGGCGCCGGAGAATAACGAGTTTTACAAAGGGAAGATTTGGTGCGTGG
TGGCTAAAGGAGCGAATTGGACTCAGCTAGGTGATGCTCTATCGTACGCTTGCTCACAGGGGAATAATACCTGTGACCCG
ATTCAACGCGGAGGCCCATGTCACAAACCCGATTTGACCGTTTTGCACGCCAGCTACGCCTTTAGCTCCTATTGGGCCCA
ATTTCGTAAGACCGGTGGGACTTGCTCTTTCAACGGCCTAGCCACCCAAACCATTAAAGATCCAAGCTACGGACGCTGTG
AGTTTCCGAGCGTGACATTGTGA