Details for Lyrate rockcress Locus 16046010

Position : sca3 ( 5`- 8247467 .. 8246260 -3` )
Annotation : [B2G] ATIPT8 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16046010

Protein [Map View]
MQNLTSTFVSRSIVPITSPRLRLPPPRSVVPMTTVCMEQSSKQKVVVIMGATGSGKSRLSIDLATRFSGEVVNSDKIQFY
NGLKVTTNQMSIPERCGVPHHLLGELPPDDSELTTSEFRSLASRSISEITARGNLPIVAGGSNSFIHALLVDRFDPQTYP
FSSEVSISSNLRYECCFLWVDVSVSVLFEYLSKRVDQMMESGMFEELAGFYNPRYSGSTIRTHGIHKTIGIPEFDRYFSL
YPPENNHKMPEWDQARKAAYEEAVQEIKENTWRLAKKQIERIVKLKSSGWDIQRLDATPSFRRSSREIWDKTVLDESVKV
VKRFLVKDKVGVIC*

DNA
ATGCAAAATCTTACTTCCACATTCGTGTCTCGTTCCATAGTCCCGATCACTTCTCCGCGACTGCGACTGCCACCACCACG
ATCAGTAGTTCCCATGACTACCGTTTGCATGGAACAATCATCCAAGCAAAAAGTGGTTGTGATCATGGGAGCCACGGGAT
CAGGCAAGTCACGTCTCTCAATCGATCTAGCAACCCGTTTCTCTGGAGAGGTCGTCAATTCTGACAAAATTCAATTCTAC
AATGGATTGAAGGTCACTACTAATCAAATGAGCATCCCTGAGAGATGTGGAGTCCCTCACCATCTCCTTGGTGAGCTCCC
TCCGGATGACAGCGAACTAACTACCTCCGAATTCCGCTCTTTGGCGTCGCGGTCCATCTCCGAGATTACTGCTCGTGGAA
ATCTCCCGATTGTAGCTGGCGGATCAAACTCCTTTATTCATGCTCTCCTTGTCGACCGTTTCGACCCCCAAACCTATCCA
TTCTCTTCCGAGGTCTCCATCTCTTCCAACTTGAGGTACGAGTGTTGCTTCCTTTGGGTGGATGTCTCAGTCTCGGTCCT
GTTCGAGTACCTCTCAAAACGTGTCGACCAGATGATGGAGTCAGGGATGTTCGAGGAGCTCGCTGGTTTCTACAACCCGA
GATATTCCGGGTCCACGATCCGAACCCACGGGATTCACAAGACCATAGGAATACCCGAGTTTGACCGGTACTTCAGCTTA
TACCCACCGGAGAATAACCACAAGATGCCCGAATGGGACCAAGCAAGAAAGGCGGCATACGAGGAAGCTGTGCAAGAGAT
CAAAGAGAACACATGGCGTCTTGCAAAGAAGCAGATTGAGAGGATCGTGAAGCTGAAAAGCAGCGGATGGGACATTCAGA
GGTTGGACGCTACGCCGTCATTCAGAAGATCGTCGAGAGAGATTTGGGACAAGACTGTTTTGGATGAAAGCGTCAAGGTT
GTGAAACGCTTCTTGGTGAAAGACAAAGTGGGAGTTATTTGTTAG