Details for Lyrate rockcress Locus 16046009

Position : sca3 ( 5`- 7305165 .. 7305866 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479186 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16046009

Protein [Map View]
LSQPIRSTTGSNKLIQVLCKSNIYPSLCDSTLNLDPRSKNSNLRGLAPISIDATSKKVNELLNYLIFVSKNIKDREDLKK
YKTCIDEYGTRARRFLPAALADLKAANVVSIPDHCEAQFAGISPLTGRNKAVHDIAYMTADIIKYLFVNN*

DNA
TTGTCTCAACCAATTCGGTCTACTACGGGATCTAATAAGCTCATACAAGTACTCTGCAAAAGTAATATTTATCCCAGCCT
CTGCGACTCTACTCTCAATCTTGATCCTAGAAGCAAGAATTCAAATCTACGAGGGCTTGCGCCGATCTCTATCGACGCGA
CTTCAAAAAAAGTCAACGAGTTGTTAAATTATCTCATTTTCGTCTCTAAGAACATCAAAGACCGTGAAGACTTAAAGAAG
TATAAAACTTGCATTGATGAGTATGGCACGAGGGCTCGTAGGTTTTTACCGGCGGCGTTGGCTGATCTTAAAGCTGCGAA
TGTTGTGTCGATACCTGATCATTGTGAGGCGCAATTCGCTGGAATTTCGCCGTTGACCGGACGTAACAAAGCCGTCCATG
ATATCGCTTATATGACTGCTGACATCATCAAATATCTTTTTGTCAATAATTAA