Details for Lyrate rockcress Locus 16046005

Position : sca3 ( 5`- 3503648 .. 3504641 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046005

Protein [Map View]
MGNASENFDIEDLMSYGDDLINLLDVRNGFDVISQSFEQFKALNFACDEDFNQIQCSIEDSLLDKQCCFSWRSFGIVRRN
SMFVRRKLRKHIQMLRLKMKLNVFRKSLTKRWNGIVADELKELNAQLISIDEHKQSTMRKERDGLRAEKKLSMYASVTKV
IPDIDGPSKISGYMVDREKRVIEKFQFETNKMTAYETCNSIWSIINKQ*

DNA
ATGGGAAATGCGTCGGAGAATTTCGATATCGAAGATCTAATGTCTTATGGAGACGATTTGATCAACTTATTGGATGTTAG
GAATGGGTTTGATGTGATATCTCAAAGTTTTGAGCAGTTTAAAGCTCTCAATTTCGCTTGCGACGAGGATTTCAATCAGA
TACAATGCTCTATTGAAGATAGTTTATTAGATAAACAATGTTGCTTTAGCTGGAGATCTTTTGGTATTGTAAGAAGAAAC
TCGATGTTTGTAAGAAGAAAACTGAGGAAGCATATTCAGATGTTGCGGCTGAAGATGAAATTGAACGTCTTCAGAAAGAG
CTTGACGAAGAGATGGAACGGGATAGTCGCTGATGAACTCAAGGAGCTGAATGCTCAATTGATATCGATTGATGAACATA
AGCAATCTACAATGAGAAAAGAGCGGGACGGCTTGAGAGCTGAGAAAAAGTTGTCTATGTATGCTTCTGTCACGAAAGTT
ATACCGGACATTGATGGCCCATCAAAGATCTCAGGCTATATGGTAGATCGTGAAAAGAGGGTAATTGAAAAGTTTCAATT
CGAGACGAATAAGATGACAGCCTACGAGACATGTAACAGTATCTGGAGCATCATAAACAAACAATAG