Details for Lyrate rockcress Locus 16045875

Position : sca3 ( 5`- 6427282 .. 6426792 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045875

Protein [Map View]
MSSNCGSCDCADKTQCVKKGTSYTFDIVKTQESYKEAMIMDVGAEENDANCKCKCGSTCSCVNCTCCPN*

DNA
ATGTCAAGCAACTGCGGAAGCTGCGACTGTGCTGACAAGACCCAGTGCGTGAAGAAGGGAACCAGCTACACCTTCGACAT
CGTCAAGACTCAGGAGAGCTACAAGGAAGCCATGATCATGGACGTTGGTGCAGAGGAGAACGACGCGAATTGCAAGTGCA
AGTGTGGCTCAACCTGCAGCTGCGTCAACTGCACTTGCTGCCCCAACTAA