Details for Lyrate rockcress Locus 16045853

Position : sca5 ( 5`- 17950022 .. 17951101 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045853

Protein [Map View]
KKKTKNKKQSRKEKEKDQTFINLPSDLLQLVISRLSLKDNIRASAVCKTWHEACVSLRVVHTSPWLIYFSKTDESYELYD
PSMQKTYNLHFPELSGFRVCYSKDGWLLMYNANSYKLLFFNPFTRDHIPVPPLWMAYDQRMAFSCAPTSTSCLLFTISSV
TWNYITIKTCCADAQEWKTFEFKNRLPRNFNTFEQIVFSNGVFYCLTNTGCLALFDPSLNSWNVLPGRPPKRPGSNGCFM
TEHQGEIFLIYMYRHMNPTVLKLDLTSFDWTERKTLGGLTIYASALSSESRAEQQKPSGISNCLCLSVFHGFKRTCIYYE
VDEESEICFKWRKQNPYENIWIMPPLNLLDLPLFDQLIK*

DNA
AAGAAGAAGACGAAAAATAAGAAGCAGAGTAGGAAGGAAAAAGAAAAGGACCAAACTTTCATAAATCTTCCCTCTGATCT
CTTACAACTGGTGATTTCCCGTCTTTCATTGAAAGACAACATCCGTGCTTCTGCTGTCTGCAAAACATGGCACGAAGCTT
GTGTTTCTCTTCGAGTGGTACACACATCTCCTTGGCTTATCTACTTTTCCAAAACAGACGAATCCTATGAACTTTATGAC
CCATCAATGCAGAAAACATACAATCTTCACTTCCCTGAGTTATCCGGTTTTCGAGTTTGTTACTCCAAAGATGGTTGGTT
ACTCATGTACAATGCCAATTCCTATAAACTCCTTTTCTTCAATCCGTTTACCCGTGATCACATACCCGTACCTCCGCTTT
GGATGGCATATGATCAAAGAATGGCTTTCTCTTGTGCCCCTACATCAACTAGTTGTCTCTTGTTCACTATCAGTTCTGTC
ACTTGGAATTACATCACCATCAAGACATGTTGTGCTGATGCTCAAGAGTGGAAAACATTTGAGTTCAAGAATCGGTTACC
GCGAAACTTCAACACTTTCGAGCAGATTGTCTTTTCAAATGGTGTCTTCTACTGCCTCACAAACACCGGATGCTTAGCGC
TCTTTGACCCATCTTTGAATTCTTGGAATGTTCTTCCCGGGCGACCTCCTAAACGTCCTGGAAGCAACGGATGCTTCATG
ACAGAACACCAAGGAGAGATCTTTCTTATTTATATGTACAGACACATGAACCCTACAGTGCTTAAACTTGATCTTACAAG
CTTTGACTGGACTGAGAGGAAAACACTAGGAGGCTTGACGATCTACGCTAGCGCTTTGTCTTCTGAATCGAGAGCCGAGC
AGCAGAAGCCGAGTGGAATAAGTAACTGTTTGTGTCTCTCTGTGTTCCATGGATTCAAGAGGACTTGCATATATTATGAG
GTTGATGAAGAGAGTGAGATCTGCTTCAAGTGGAGAAAACAGAATCCGTATGAGAATATTTGGATCATGCCACCACTCAA
CCTCCTTGATCTCCCTTTATTTGATCAACTTATCAAGTAA