Details for Lyrate rockcress Locus 16045824

Position : sca3 ( 5`- 6266174 .. 6268280 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045824

Protein [Map View]
MASSTKTVLIPIAHGTEPLEAVAMITVLRRGGADVTVASVETQVGVDACHGIKMVADTLLSDITDSVFDLIVLPGGLPGG
ETLKNCKPLENMVKKQDSDGRLNAAICCAPALALGTWGLLEGKKATGYPVFMEKLAATCATAVESRVQIDGRIVTSRGPG
TTIEFSVTLIEQLFGKEKADEVSSILLLRPNPGEEFTFTELNQTTWSFEDTPQILVPIAEESEEIEAIALVDILRRAKAN
VVIAAVGNSLEVVGSRKAKLVAEVLLDEVAEKSFDLIVLPGGLNGAPRFASCEKLVNMLKKQAEANKPYGGICASPAYVF
EPNGLLKGKKATTHPVVSDKLSDKSHIEHRVVVDGNVITSRAPGTAMEFSLAIVEKFYGREKALQLAKATLV*

DNA
ATGGCTTCATCTACGAAGACGGTTTTGATCCCTATTGCACACGGTACGGAGCCTTTAGAAGCGGTGGCGATGATCACCGT
GTTGCGTCGAGGTGGTGCTGACGTGACGGTGGCTTCCGTCGAGACTCAGGTTGGCGTTGATGCTTGTCATGGCATCAAGA
TGGTCGCTGATACTCTTCTCTCTGATATTACCGACTCTGTTTTCGACCTTATTGTGCTCCCCGGAGGGCTTCCCGGTGGC
GAGACTCTTAAAAACTGTAAACCTTTAGAGAACATGGTTAAGAAACAAGACTCTGATGGACGACTTAACGCAGCTATCTG
TTGTGCTCCTGCGTTGGCTCTTGGTACTTGGGGTCTACTAGAAGGCAAAAAAGCAACGGGTTACCCTGTTTTTATGGAGA
AACTTGCAGCTACTTGTGCCACTGCTGTTGAGTCAAGAGTGCAAATAGATGGAAGAATAGTGACTAGTCGTGGACCAGGA
ACCACCATTGAATTCTCCGTCACGCTTATAGAGCAGTTGTTTGGGAAAGAGAAAGCTGATGAAGTCTCTAGTATCTTGCT
GCTTCGTCCCAACCCTGGTGAGGAGTTTACTTTTACTGAGCTTAACCAAACGACCTGGTCATTCGAAGATACACCACAGA
TTCTCGTACCCATTGCAGAGGAGTCAGAGGAAATTGAAGCCATTGCGCTTGTAGATATCCTGAGACGGGCAAAAGCAAAC
GTAGTGATTGCTGCAGTTGGTAACAGTTTGGAAGTTGTAGGATCTCGCAAAGCTAAGCTAGTAGCAGAAGTGCTTCTTGA
TGAAGTTGCAGAGAAGTCGTTCGATCTGATTGTGTTACCTGGCGGTCTTAACGGTGCTCCAAGATTCGCTAGCTGCGAGA
AACTGGTGAACATGTTAAAGAAACAGGCAGAAGCAAACAAACCATATGGAGGAATCTGCGCATCGCCTGCGTACGTCTTC
GAGCCTAATGGTTTACTGAAGGGTAAGAAGGCTACTACTCACCCAGTAGTGAGCGACAAACTTTCGGATAAGAGTCACAT
TGAGCATAGAGTCGTGGTAGATGGAAATGTCATAACAAGCAGAGCTCCAGGGACTGCAATGGAGTTTTCACTTGCGATTG
TCGAAAAGTTTTACGGGCGAGAGAAAGCACTTCAGCTCGCAAAGGCCACACTTGTGTGA