Details for Lyrate rockcress Locus 16045821

Position : sca3 ( 5`- 5293676 .. 5294276 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045821

Protein [Map View]
MDQIKPEFLKKLTKFIAVSIWIFSLLTTHNFYLYRFMIQLVTHAVDKNYMFLLCNGLLVVVAKCSGLVASSKPIEKFWSN
TDKTFDYGDFESYNAILEVKYNSVNGIGTEYSFLLAEEVTVEEDTKHQETEENEEDDDDNTLADNEGEEECDLRDGSINE
EEEEENVEVMTSTEEEMNKKFDEFIRKMKEELRIEAKRHL

DNA
ATGGATCAAATAAAACCGGAGTTTCTGAAAAAATTGACGAAGTTTATAGCAGTTTCGATATGGATTTTCTCTCTTTTAAC
CACTCACAACTTCTATTTATATAGATTCATGATTCAACTCGTAACACACGCAGTAGATAAAAACTACATGTTCCTCCTCT
GCAATGGTCTCTTAGTGGTTGTTGCGAAGTGCTCTGGTTTGGTCGCTTCGTCGAAACCAATAGAGAAATTTTGGAGTAAT
ACCGATAAAACCTTTGATTATGGAGATTTCGAGAGTTACAATGCGATATTGGAGGTGAAGTATAATTCTGTTAATGGAAT
AGGAACAGAGTACTCCTTTCTTCTTGCAGAGGAAGTTACTGTAGAGGAGGATACAAAACATCAAGAAACCGAAGAAAACG
AAGAAGATGACGATGACAACACATTAGCAGATAATGAAGGAGAGGAAGAGTGTGATCTTCGTGACGGATCTATAAACGAG
GAAGAAGAAGAAGAGAACGTAGAAGTGATGACATCGACGGAGGAGGAGATGAATAAGAAGTTCGACGAGTTCATCAGAAA
GATGAAGGAAGAGCTTAGAATCGAAGCTAAACGGCATTTAA