Details for Lyrate rockcress Locus 16045790

Position : sca3 ( 5`- 1547513 .. 1545338 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896488 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16045790

Protein [Map View]
MVTPTTIRTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTALRLEKEVAEIAGKEAAMFVPSGTMGNLISVLVHCDE
RGSEVILGDDSHIHIYENGGISSLGGVHPRTVKNEEDGTMEIGAIEAVVRSPKGDLHHPVTKLICLENTQANCGGRCLPV
EYIDKVGELAKKHGLKLHIDGARIFNASVALGVPVKRIVHAADSVSICLSKGIGAPVGSVIVGSKEFITKARWLRKTLGG
GMRQIGVLCAAALVALHENVAKLEDDHKKARFLAEGLSRIERLRVNVAAVETNIIYVDIPEDPKFGAEEACKSLEDVGVL
IIPQATFRIRIVLHHQISDVDVEYVLSCFEKTF*

DNA
ATGGTGACGCCAACTACAATTAGAACCGTGGATCTCCGCTCCGACACGGTGACTAAACCAACGGAGTCAATGCGCTCAGC
GATGGCAAACGCGGAAGTAGACGACGACGTTTTGGGAAACGATCCAACGGCTCTGCGTTTGGAGAAAGAGGTGGCTGAGA
TCGCCGGAAAAGAGGCGGCTATGTTTGTTCCGTCGGGAACAATGGGGAATCTGATAAGCGTGTTGGTTCATTGTGACGAG
AGAGGGAGTGAAGTGATTCTTGGAGATGACTCTCACATTCATATATATGAAAACGGCGGCATTTCAAGCCTCGGCGGTGT
GCATCCGAGGACGGTGAAGAACGAGGAAGACGGTACGATGGAGATTGGTGCTATTGAAGCTGTCGTGAGGAGTCCCAAAG
GAGATCTTCATCATCCGGTTACTAAGCTTATATGTCTTGAGAACACTCAAGCAAATTGTGGAGGTAGATGCCTGCCTGTC
GAATATATAGACAAAGTCGGAGAATTAGCCAAGAAACATGGTTTGAAGCTTCACATTGACGGAGCTAGGATCTTTAACGC
TTCTGTGGCACTTGGAGTTCCTGTGAAGAGGATTGTTCATGCAGCTGATTCAGTCTCGATTTGTTTGTCGAAAGGTATAG
GTGCACCGGTCGGTTCGGTAATCGTGGGAAGCAAGGAGTTCATCACTAAAGCAAGGTGGTTAAGGAAAACTTTAGGCGGA
GGAATGAGACAGATAGGTGTGCTCTGCGCCGCCGCGTTGGTGGCTCTCCATGAAAATGTCGCCAAGCTCGAAGATGACCA
CAAGAAAGCTAGGTTCTTGGCAGAAGGACTGAGCCGGATTGAACGGTTAAGAGTAAACGTGGCAGCTGTGGAAACCAACA
TCATATACGTAGACATACCAGAAGATCCAAAATTTGGAGCAGAAGAGGCATGTAAGAGTTTGGAAGATGTCGGTGTGCTT
ATCATACCCCAAGCTACATTCAGAATCAGGATTGTTCTACATCACCAAATCTCAGACGTCGACGTGGAATATGTACTCTC
TTGCTTTGAGAAAACGTTTTAG