Details for Lyrate rockcress Locus 16045776

Position : sca3 ( 5`- 1858052 .. 1859669 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045776

Protein [Map View]
MAFFSSSSSSSSSSPAMQKGVFVSMPVLVLSVSFAAAVFFLISSSFSSCSCPESLSSSRNDAVEASVGGSGGDLRLEERI
SPTQEDIEWVRDLIRSNGLHMQKNELRKGINPRTRDQQLADLKQYKGISHYEGDEANNHTALPCPGELLVEQHHSNYGEP
WAGGRDVFEFLAESSNLKPNSRVLEIGCGTLRVGLHFIRYLNPQHFHCLEKDELSLMAALRYELPSQGLLHKRPLIVRGD
DMEFSKFGSDTTYDLIYASAVFLHMPDKLVWTGLERLVDKLKPYDGRIFVSHNVKFCSRLGQDKCSQKLASLGLEYLGKQ
THDSLLFNHYEIWFGFRRFKT*

DNA
ATGGCGTTTTTCTCCTCTTCTTCTTCTTCTTCTTCATCGTCTCCGGCGATGCAGAAAGGAGTCTTCGTGTCCATGCCTGT
ACTCGTACTCTCCGTTTCGTTTGCAGCTGCTGTCTTCTTCCTCATCTCGTCTTCTTTCTCGTCTTGCTCCTGTCCTGAAT
CTTTATCTTCTTCCCGGAACGACGCCGTTGAAGCTTCCGTCGGTGGAAGCGGCGGTGATTTGAGATTGGAGGAGAGGATA
TCGCCGACGCAGGAGGATATTGAGTGGGTTAGAGATCTGATTAGATCCAACGGTTTGCATATGCAGAAGAATGAGCTTCG
AAAAGGGATTAATCCTCGCACTAGAGATCAACAACTCGCAGATCTGAAACAGTACAAGGGTATATCCCATTACGAAGGAG
ATGAAGCAAACAACCACACAGCTCTTCCATGTCCTGGTGAGTTACTAGTTGAGCAGCATCACAGCAACTATGGTGAACCG
TGGGCAGGTGGTCGCGATGTATTCGAGTTCTTGGCTGAATCATCCAATCTTAAACCAAACTCTCGTGTTCTTGAAATTGG
ATGCGGCACGTTACGTGTGGGTTTGCATTTCATCCGCTATCTCAATCCCCAACATTTTCACTGCCTTGAAAAGGACGAAC
TTTCTCTAATGGCTGCTTTAAGGTACGAGCTTCCATCTCAAGGACTTCTACATAAACGACCTCTTATAGTCAGAGGCGAT
GACATGGAATTCAGCAAGTTTGGTTCAGATACAACCTATGATCTGATATACGCAAGTGCAGTCTTTCTCCACATGCCTGA
TAAACTCGTGTGGACTGGACTCGAAAGACTAGTAGACAAGTTGAAGCCCTACGACGGGAGAATCTTTGTGTCACATAACG
TAAAGTTTTGTTCGCGGTTAGGACAAGACAAGTGTTCGCAGAAGCTAGCAAGTTTAGGACTTGAGTATCTTGGAAAACAA
ACACATGATAGCCTGCTGTTTAATCACTACGAGATCTGGTTCGGGTTTAGACGGTTCAAAACATAA