Details for Lyrate rockcress Locus 16045774

Position : sca5 ( 5`- 17896096 .. 17897871 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16045774

Protein [Map View]
MLSTLSPKTLSSSFTVQKSQNPRCKSPNSCRFQSSKCRFNPIFVKSEVQTERNLEFETGETFFRHESARGRDLGILSATL
YKRSNGSLRVLDAMCGCGIRSLRYLVEADADFVMANDANDANRRVITDNLSKVERGVGDERRWVVTHMLANKAMIERYMV
ADFFDMIDIDSFGSDSSFLRDAFNALRLGGLLYLTSTDGYSSGGHRPYNSLAAYGAFIRPMPFGNEIGLRMLIGGAVREA
ALLGYHVMPLFSYYSYHGPVFRVMLRVHRGKLHEDRNYGFVTHCNLCGHSHTLRWDELGLMGCPCSDTKASSSLVVSGPM
WLGPLHDASYVTEMLELAKEWGWVSEGTGMDLEKLLSIMIEESDPRLPPGYTKMDEMASRAKMNSPPLKKMMSALVKEGY
AASRSHIIPNALKTDCPMSHFVRIAKDNLQS*

DNA
ATGTTGTCAACTCTCTCTCCTAAAACCCTATCTTCTTCCTTCACTGTGCAAAAATCGCAAAACCCTAGATGTAAATCCCC
AAATTCATGTCGATTCCAGAGTTCTAAATGTAGATTCAATCCAATTTTCGTGAAATCCGAGGTTCAGACTGAGAGGAATC
TCGAATTTGAAACGGGAGAGACATTTTTCCGCCATGAAAGCGCTAGAGGACGAGACCTCGGTATTTTGTCAGCGACGCTG
TACAAGAGATCTAATGGAAGCTTACGGGTACTCGACGCAATGTGCGGATGTGGAATTAGGTCGCTTCGTTATCTTGTGGA
AGCTGATGCTGATTTCGTGATGGCGAATGACGCGAACGATGCTAATCGGAGAGTGATTACGGATAATCTGAGTAAAGTAG
AGAGAGGTGTTGGTGATGAGAGGAGATGGGTCGTGACGCATATGTTGGCTAATAAAGCGATGATTGAGCGATATATGGTT
GCGGATTTCTTCGATATGATTGACATTGATTCGTTTGGGAGCGATTCGTCGTTTTTGAGAGATGCGTTTAATGCATTGAG
ATTGGGTGGTTTGCTTTACTTGACCTCAACTGATGGTTACTCTTCCGGTGGCCACAGACCTTATAATTCTTTAGCAGCTT
ATGGAGCATTTATTCGGCCTATGCCATTTGGGAATGAGATTGGGCTGCGGATGCTTATAGGTGGAGCAGTAAGAGAGGCC
GCTCTGCTGGGTTATCATGTTATGCCTCTTTTCTCCTACTATTCTTATCATGGACCTGTGTTTAGAGTCATGCTGAGGGT
TCACCGTGGGAAGCTACATGAGGACAGGAACTATGGTTTTGTCACGCACTGTAACCTATGTGGCCATTCGCATACATTGA
GATGGGATGAACTTGGTTTGATGGGATGTCCCTGCAGTGATACAAAGGCTTCTTCTTCACTGGTTGTTTCAGGACCAATG
TGGCTTGGACCGCTTCATGATGCTTCGTATGTTACGGAAATGCTGGAATTGGCAAAGGAATGGGGATGGGTCAGTGAAGG
CACTGGCATGGATCTAGAGAAGCTTCTCAGCATAATGATCGAAGAGAGTGATCCAAGACTACCCCCTGGATACACCAAAA
TGGATGAGATGGCGAGCCGAGCAAAGATGAACTCACCTCCGTTGAAGAAGATGATGAGTGCACTAGTCAAGGAGGGATAC
GCTGCTAGCAGATCTCACATTATCCCCAACGCACTCAAAACAGATTGTCCCATGTCACATTTCGTAAGGATTGCCAAAGA
TAATTTGCAGAGTTAA