Details for Lyrate rockcress Locus 16045757

Position : sca3 ( 5`- 6589984 .. 6592143 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479016 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16045757

Protein [Map View]
MWRRIVSSQLKTLAADVVVAASPRRSLAATVRPVGFYLAANRSAISASSFVIPRHFSSESVETPAKKKVEDVMPIATGHE
KEELEAELEGRRLDDIDFPEGPFGTKEAPAIVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFELEVVG
PGGPPDGHGDEDDEHHH*

DNA
ATGTGGAGAAGAATCGTCTCCTCTCAACTCAAAACCCTAGCCGCCGATGTCGTCGTCGCTGCTTCTCCTCGTCGATCGTT
AGCCGCCACCGTTAGACCCGTCGGTTTCTACCTCGCCGCCAATCGATCAGCCATTTCCGCCTCTTCTTTCGTTATCCCTC
GCCATTTCAGCTCCGAATCAGTGGAGACTCCTGCGAAGAAGAAGGTGGAGGATGTAATGCCAATTGCAACTGGACACGAG
AAGGAGGAGCTTGAGGCTGAACTTGAGGGAAGGAGGCTGGATGATATTGACTTCCCTGAAGGTCCTTTTGGAACAAAGGA
AGCTCCTGCTATTGTGAAGTCTTACTATGACAAGCGAATTGTGGGATGCCCTGGTGGTGAAGGCGAGGACGAGCACGATG
TTGTCTGGTTCTGGCTGGAGAAAGGAAAGTCTTTTGAATGCCCGGTTTGCACTCAGTACTTTGAGCTGGAAGTGGTTGGT
CCTGGTGGGCCTCCAGATGGTCACGGTGATGAAGACGATGAGCACCACCACTGA