Details for Lyrate rockcress Locus 16045748

Position : sca3 ( 5`- 9317477 .. 9320168 -3` )
Annotation : [B2G] rna recognition motif-containing protein
External links : CoGe
PGDD synteny : 16045748

Protein [Map View]
MDPGDPTSILFTKIRTLEPDFASKIIGYLLLQDLGTRDLMRLALGPDTLLQSVCLKAKSALGLSSNGSSSASSPLNPISR
PINIHRHSLSQSSPGNGFMEFSRNNPLSPSLTTPGSLGSNPNMISSPFQASSSLFASDGGAAGDSTGNGDFLDEQQLGNY
LSFLNESSSKNNDESLDPFGFSADNGDAHLHKRSFSASDACFGSEEPGFGGGGYNRFPHGGLGDDFDSPGGFGSPDYVSR
QQEEMVRMKMAQRQRMAAAQYLAATGSPMSYEKGLNFLLHQRNVHRSGAGQYGEEGYWFGSPGRHERDEFMGMGDKSNSA
SKQIYLTFPADSSFTDEDVSNYFGTFGPVQDVRIPYQQKRMFGFVTFVHSETVRIILARGNPHFICDSRVLVKPYKEKGR
ILEKRQQQQLLQQMERGNFSPGSSPSGMDSRDLFESLLSPRMFSNTQEMMRRKAEQADLQQAIEFQRRRFLNLQLPDMDS
ESFLHHQRSLSIGSPVHFSPRVNQSMLFRSENTSDEVFEGNGDSGHFQSEATRAFLSDTGHNSSQERVYNNHLNKGQETT
LENALPDSFFSSPSKTGETQHPEFEKENCATLAVTTENKAASSIQSA*

DNA
ATGGATCCGGGAGATCCTACTTCGATACTTTTCACAAAGATCAGAACTTTAGAACCAGACTTCGCTTCAAAAATCATTGG
TTACTTGCTTTTACAGGACTTGGGTACGAGAGATTTGATGCGTTTGGCTCTTGGACCAGACACTCTCTTGCAGTCCGTTT
GTCTCAAAGCTAAATCTGCTTTAGGTCTTTCTTCTAATGGATCTTCTTCTGCTTCGTCGCCATTGAACCCTATCTCCAGA
CCCATTAACATCCACCGTCATTCTCTGTCTCAGTCTTCACCGGGAAATGGGTTTATGGAGTTTTCGAGGAACAACCCTTT
GTCTCCTTCTTTGACTACTCCTGGTTCACTCGGAAGTAACCCTAACATGATTTCGAGTCCGTTTCAAGCAAGTTCGTCTC
TTTTTGCTTCTGACGGTGGTGCTGCTGGTGATTCCACTGGAAACGGCGATTTCCTCGATGAGCAGCAACTAGGGAACTAC
TTGTCGTTTCTTAACGAGTCTTCTTCGAAGAATAACGACGAATCTCTGGATCCGTTTGGGTTCTCTGCTGATAATGGCGA
TGCCCATTTGCATAAGAGGAGTTTCTCTGCCAGTGATGCTTGTTTCGGCTCAGAAGAGCCCGGATTTGGCGGCGGCGGTT
ACAATAGGTTCCCTCACGGTGGTTTAGGTGATGATTTTGATTCTCCTGGTGGTTTTGGCTCGCCGGATTATGTTTCCAGG
CAGCAAGAGGAGATGGTGAGGATGAAGATGGCTCAGAGACAGCGAATGGCCGCTGCTCAGTACTTGGCGGCTACTGGTTC
TCCAATGTCGTATGAAAAAGGCCTCAATTTTCTCTTGCATCAACGTAATGTGCATAGATCAGGAGCAGGACAATATGGGG
AAGAGGGTTACTGGTTTGGTAGTCCAGGCCGGCATGAAAGGGATGAGTTTATGGGAATGGGAGATAAATCTAACTCTGCT
TCTAAACAGATTTACTTGACATTTCCAGCTGACAGCTCCTTCACAGATGAAGATGTCTCCAATTATTTTGGCACTTTTGG
ACCAGTGCAAGATGTTAGGATTCCATACCAGCAGAAACGGATGTTTGGGTTTGTCACTTTTGTCCACTCTGAAACTGTGA
GAATCATATTGGCGAGAGGAAATCCTCATTTCATCTGTGACTCACGTGTGCTCGTTAAACCGTACAAGGAGAAGGGAAGA
ATCCTTGAAAAGAGGCAGCAGCAACAACTGCTGCAGCAGATGGAGAGAGGAAACTTTTCTCCTGGTTCAAGTCCATCTGG
AATGGATTCCAGAGATCTCTTTGAATCTCTTCTCTCACCAAGGATGTTTTCGAACACACAGGAGATGATGAGGAGAAAAG
CTGAGCAAGCTGACCTGCAACAAGCAATAGAATTCCAGAGGAGAAGATTTCTGAATCTGCAGTTGCCCGACATGGACAGT
GAATCGTTTCTCCATCACCAGCGTAGTCTTTCTATTGGATCCCCCGTTCATTTTTCCCCTCGTGTCAATCAAAGCATGCT
CTTTCGATCAGAAAACACCAGTGATGAAGTCTTCGAAGGTAATGGTGATTCAGGACATTTTCAGTCTGAAGCAACCCGAG
CTTTTCTGAGTGATACTGGTCACAACAGCAGCCAAGAACGTGTTTACAATAACCATCTCAACAAAGGGCAAGAGACAACT
CTGGAGAACGCTCTGCCTGATAGCTTCTTTTCTTCCCCATCGAAGACCGGTGAAACCCAACACCCCGAGTTTGAGAAAGA
GAATTGTGCTACTCTCGCTGTTACTACAGAAAATAAGGCAGCCTCGTCAATTCAATCAGCCTAG