Details for Lyrate rockcress Locus 16045717

Position : sca3 ( 5`- 7759069 .. 7759563 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045717

Protein [Map View]
MAGESSTAAALKIRSCRRKGLRRNPTKIKEAVLDLISSLPDDILQHILSFIQTKIAIKTSLLSKRWRHVWCGTPSLSFSC
NRVEAPFINKTLTRYTSSKMMSFKLHSNLSENVPHLDSWIEFLISRNVENLSMTLWHSDEYKFPDFFYINSSVKQLFVEL
IRLR*

DNA
ATGGCAGGCGAGAGCTCCACCGCCGCTGCTTTAAAAATCCGTAGCTGCCGCCGCAAAGGCCTTCGTCGCAACCCCACGAA
AATCAAAGAAGCAGTACTAGACTTAATAAGCTCTTTACCTGATGATATCCTACAACATATCCTCTCCTTTATTCAGACCA
AAATCGCCATCAAAACTTCCCTCTTGTCAAAACGATGGAGGCATGTATGGTGTGGTACACCTTCTCTATCATTTAGTTGT
AATAGAGTGGAGGCTCCTTTTATAAATAAAACCCTAACTCGCTATACATCTTCCAAGATGATGAGTTTTAAGCTCCATTC
GAACTTGTCCGAAAATGTTCCCCACCTCGACAGTTGGATCGAGTTCCTCATATCACGTAACGTGGAGAATCTGTCTATGA
CTTTATGGCATTCCGATGAGTACAAGTTTCCTGATTTCTTCTACATCAATTCTTCTGTCAAGCAACTCTTTGTGGAGTTA
ATTAGACTGCGCTGA