Details for Lyrate rockcress Locus 16045699

Position : sca3 ( 5`- 8105841 .. 8104525 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_318646 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16045699

Protein [Map View]
MEKKSVKISDKLSLIRVLRGIICLMVLVSTAFMMLIFWGFLSAVLLRLFSVRYSRKCVSFFFGSWLALWPFLFEKINRTK
VIFSGDKVPCEDRVLLIANHRTEVDWMYFWDLALRKGQIGNIKYVLKSSLMKLPLFGWAFHLFEFIPVERKWEVDEANLR
QILSSFKDPRDALWLALFPEGTDYTEAKCERSKKFAAENGLPILNNVLLPRTKGFVSCLQELSCSLDAVYDVTIGYKTRC
PSFLDNVYGIEPSEVHIHIRRINVTQIPNQEKDINAWLMNTFQLKDQLLNDFYSNGHFPNEGTEKEFNTKKYLINCLAVI
AFTTICTHLTFFSSMIWFKIYVSLACAYLTSATHFNLRSVPLVETAKKAFKLLNK*

DNA
ATGGAAAAGAAGAGCGTAAAAATTTCTGATAAGTTGTCTCTGATTAGAGTGTTAAGAGGTATAATATGTTTGATGGTGTT
AGTTTCAACAGCTTTTATGATGTTAATATTCTGGGGGTTCCTATCAGCTGTATTGTTGAGGCTTTTCAGCGTACGCTATA
GCCGTAAATGTGTTTCCTTCTTCTTTGGTTCGTGGCTCGCCTTGTGGCCCTTCCTCTTTGAGAAGATTAACAGGACCAAA
GTTATCTTCTCTGGCGATAAGGTTCCTTGCGAGGATCGAGTATTGCTCATTGCAAACCACCGAACAGAAGTTGATTGGAT
GTACTTCTGGGATCTTGCACTGCGTAAAGGCCAGATTGGGAATATAAAATATGTGCTTAAGAGTAGTTTGATGAAATTAC
CTCTCTTTGGTTGGGCGTTTCACCTCTTTGAGTTTATTCCCGTTGAGCGGAAATGGGAAGTCGATGAAGCAAACTTGAGG
CAGATACTTTCGAGTTTTAAGGATCCCCGAGACGCTTTATGGCTTGCTCTTTTCCCCGAGGGCACAGATTACACAGAGGC
TAAATGCGAAAGGAGTAAGAAATTTGCTGCTGAAAATGGCCTTCCAATACTGAACAACGTTCTGCTTCCCAGAACAAAAG
GTTTCGTCTCCTGCTTGCAAGAATTGAGTTGCTCACTTGATGCAGTTTATGATGTGACCATCGGTTATAAAACCCGCTGC
CCATCTTTCTTAGACAATGTTTATGGAATTGAGCCATCAGAAGTTCACATCCACATCCGTCGTATCAACGTAACCCAAAT
CCCAAATCAAGAAAAGGACATCAATGCTTGGTTAATGAACACATTCCAGCTCAAAGACCAGCTGCTCAATGACTTTTACT
CCAATGGCCATTTCCCGAACGAAGGAACAGAGAAAGAGTTCAACACAAAGAAGTACCTCATAAACTGCTTGGCAGTGATT
GCCTTCACCACCATCTGTACGCATCTCACCTTCTTCTCATCAATGATTTGGTTCAAGATTTATGTCTCTTTGGCCTGTGC
CTACTTGACCTCTGCTACACATTTCAATCTTCGTTCTGTTCCACTTGTTGAGACTGCAAAAAAAGCCTTCAAATTACTAA
ACAAATAA