Details for Lyrate rockcress Locus 16045652

Position : sca3 ( 5`- 2536239 .. 2536415 -3` )
Annotation : [B2G] ribosomal protein l33 family protein
External links : CoGe
PGDD synteny : 16045652

Protein [Map View]
MGDKRKKTFMFIRLVSAAGTGFFYVKRKSTKGLLEKLEFRKYDPRVNRHVLFTEQKMK*

DNA
ATGGGTGACAAGAGGAAGAAGACGTTCATGTTCATCCGTCTAGTCTCAGCAGCTGGAACTGGATTCTTCTATGTCAAGAG
GAAGAGTACTAAGGGACTTCTTGAGAAGCTCGAGTTCCGTAAGTACGATCCTCGAGTTAATCGCCATGTCCTCTTTACAG
AGCAGAAAATGAAGTGA