Details for Lyrate rockcress Locus 16045639

Position : sca3 ( 5`- 757749 .. 758882 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045639

Protein [Map View]
MVLPWRSRGGVAKRRNQLIAGDISVVETKIPVQLRSSRMERIESPRVLLAPYDAVEISRRLENAAAREEYGECFEIVTKI
KNLGREGGDTNKKCLVQNGGVLALSSCFERFAAAREGHDRLLEEILFVLSSWLPLNRSEGFNKMGSTASLNCLVRFLNGK
DAKTRQNAAFCIREVIAVDKRYVYALKDMEGACEGLVKIIRDSVSTSSAKASLMVIYRAISCNDQIAARFVRLGLVEVIT
EMMVNNAEQSVCERSLVVLNAICDNEQGKEDVLRNALIVPLLVKKVLRVSDLATQCSVSILWKLWKNNGKSDDCLLVEAL
QVGAFEKLLVLLQVGCEDKTKEKASELLRNLNRCRNEIEKTNCVDSSMHLKNVKKSF*

DNA
ATGGTGTTACCTTGGAGATCAAGAGGAGGAGTAGCAAAGAGACGCAATCAATTGATTGCCGGCGATATATCCGTCGTGGA
AACCAAGATTCCGGTTCAACTCCGATCATCAAGGATGGAGCGGATTGAGTCACCGCGGGTGCTGTTGGCGCCGTATGATG
CCGTTGAGATAAGTCGGAGATTGGAAAATGCGGCGGCGCGTGAGGAATATGGCGAGTGTTTCGAGATTGTAACCAAAATC
AAGAACTTGGGAAGAGAAGGAGGGGACACGAACAAGAAGTGTTTGGTCCAAAACGGCGGAGTTTTAGCTCTGTCTTCTTG
TTTCGAAAGATTCGCGGCGGCGCGTGAGGGACACGATCGTCTTTTGGAGGAAATCTTGTTTGTTCTATCTTCATGGTTGC
CTCTGAATCGATCAGAAGGTTTCAACAAGATGGGATCAACAGCCTCGCTTAACTGTCTCGTACGGTTCTTGAACGGTAAG
GACGCTAAAACGAGACAAAACGCTGCGTTTTGTATCAGAGAGGTTATTGCAGTAGACAAGAGGTACGTGTATGCGTTAAA
AGATATGGAAGGAGCTTGTGAAGGATTAGTTAAGATCATCAGAGACTCTGTTTCGACTAGCTCGGCGAAAGCATCGCTAA
TGGTGATTTATAGAGCGATTTCTTGTAACGACCAGATCGCTGCAAGATTTGTGAGACTGGGTTTGGTTGAAGTGATCACA
GAGATGATGGTGAACAATGCCGAACAGAGCGTTTGCGAGAGATCTCTAGTTGTTCTTAACGCTATATGCGATAACGAGCA
AGGCAAAGAAGATGTTCTTAGAAACGCTTTGATCGTTCCTCTTCTAGTTAAGAAGGTTCTTAGAGTTTCGGATCTCGCGA
CACAATGTTCGGTCTCGATTCTTTGGAAGCTATGGAAGAATAATGGAAAATCTGATGATTGTTTGCTAGTTGAAGCTCTT
CAAGTTGGTGCCTTTGAGAAACTTTTAGTGCTCTTACAAGTCGGGTGCGAGGATAAGACGAAGGAGAAAGCGAGCGAGCT
CTTACGGAATTTAAACCGTTGTAGAAACGAGATCGAGAAGACAAATTGTGTCGATTCTTCAATGCATTTGAAGAATGTGA
AGAAATCATTCTAA