Details for Lyrate rockcress Locus 16045592

Position : sca3 ( 5`- 5195576 .. 5195758 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045592

Protein [Map View]
MAKNKDDIKYATAQAKLSEDEPIRVSYKHGTPLEGGKIAESEPVELFSSAQRIEKGKDHSA

DNA
ATGGCAAAGAACAAGGACGACATAAAGTACGCAACGGCTCAAGCGAAGCTATCGGAAGACGAACCTATCCGTGTAAGTTA
CAAACACGGGACACCATTAGAAGGAGGCAAGATCGCAGAGTCGGAGCCTGTAGAGCTGTTCTCGAGCGCTCAACGTATCG
AGAAGGGGAAAGATCATTCAGCA