Details for Lyrate rockcress Locus 16045568

Position : sca3 ( 5`- 4210207 .. 4209827 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045568

Protein [Map View]
MDLELLQDLSKFNFPTPIKIRSKTSKTKKDEGDADEDGLSCSTPTSQEHKIPAVVDSPPPPPRKPRPPPSAPSATAALMI
RSCKRKLLVSTCEIIMNREEIDRFFSSVYNETSTTAKRRRSYPYCAR

DNA
ATGGATCTTGAGTTATTACAAGATTTGTCCAAATTCAATTTCCCAACACCCATCAAGATCCGATCCAAAACCTCAAAAAC
CAAGAAGGACGAAGGTGATGCCGACGAAGATGGCCTCAGCTGCAGTACACCCACATCCCAAGAACACAAGATTCCCGCCG
TCGTAGACTCTCCACCTCCTCCGCCGCGAAAACCCCGACCACCACCGTCAGCACCGTCTGCTACGGCGGCTCTGATGATC
AGATCGTGCAAGAGGAAGCTTTTAGTGTCGACTTGTGAGATAATTATGAATCGGGAAGAGATTGACCGTTTCTTCTCCTC
CGTATACAATGAGACGTCGACTACAGCTAAACGGCGGAGAAGTTATCCGTATTGTGCTCGA