Details for Lyrate rockcress Locus 16045562

Position : sca3 ( 5`- 4653255 .. 4656102 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045562

Protein [Map View]
MPRQNQSVENLLLLGKIRKRGCSSPTSSTSSILREGYRFKRAIVVGKRGGSTTPVPTWRLMGRSPSPRASGALHAASPSS
HCGSKTGKVSAPAPVSARKLAATLWEMNEMPSPRVVEAAVPMIRKSRKERIAPLPPPRSSVHSGSLPPHLSDPSHSPVSE
RMERSGTGSRQRRASSTVQKLRLGDCNVGARDPISNGSFMDIETRSRVETPTGSTVGVKTRLKDCSNALTTSKELLKIIN
RMWGQDDRPSSSMSLVSALHSELERARLQVNQLIHEHKPENNDISYLMKRFAEEKAAWKSNEQEVVEAAIESVAGELEVE
RKLRRRFESLNKKLGKELAETKSALMKAVKEIENEKRARVMVEKVCDELARDISEDKAEVEELKRESFKVKEEVEKEREM
LQLADALREERVQMKLSEAKHQLEEKNATVDKLRNQLQTYLKAKRCKEKTREPPQTQLQNEETGDYLNHHIGFGSYNIED
GEVENGNEEDSGESDLHSIELNIDNKSYKWPYGEENRGRKSTPRKSLSLQKSISDCVDWVVQSEKLQKSGDGGLDWGRSI
EVEPKGYLDETQAYKPNKASSKDHHLVSGSRLSNFRGGSVSKSRLSDASKGENQNARKSRW*

DNA
ATGCCGAGGCAGAATCAAAGCGTAGAGAATCTACTTCTACTTGGCAAAATCAGGAAACGTGGTTGTTCTTCGCCGACATC
GTCGACTTCTTCGATTCTCCGTGAAGGTTATAGATTCAAAAGAGCGATTGTTGTTGGTAAAAGAGGAGGATCCACTACTC
CTGTTCCTACATGGAGACTTATGGGCCGATCTCCTTCTCCACGAGCTTCCGGTGCTTTACACGCTGCGTCTCCGTCGTCG
CACTGCGGGAGCAAAACCGGTAAAGTATCAGCTCCTGCTCCGGTTTCAGCTAGGAAGTTAGCTGCGACGCTTTGGGAGAT
GAACGAGATGCCTTCACCTAGAGTGGTGGAGGCGGCGGTGCCAATGATTAGAAAGAGTAGAAAGGAGAGAATCGCGCCGC
TTCCTCCGCCGAGATCATCGGTTCATTCTGGTTCTCTACCGCCTCATCTTTCTGATCCGTCGCATAGTCCAGTCTCTGAG
AGGATGGAAAGATCAGGGACTGGGAGTCGCCAGAGAAGAGCATCATCAACTGTGCAGAAGCTTAGGCTTGGAGACTGCAA
TGTTGGGGCTAGGGATCCTATTAGCAATGGCAGCTTCATGGATATTGAGACTCGATCACGGGTGGAGACACCGACTGGGT
CAACTGTGGGTGTCAAAACACGGTTGAAGGATTGTAGTAACGCTCTCACAACATCGAAAGAGCTTCTCAAAATCATTAAT
AGAATGTGGGGTCAAGACGACCGCCCATCTTCTAGCATGTCCCTGGTCTCTGCTTTACATTCTGAGCTCGAAAGAGCTCG
CTTACAGGTCAATCAGTTAATCCACGAACATAAACCGGAAAACAACGACATTAGCTACTTGATGAAGCGTTTTGCCGAAG
AGAAAGCAGCGTGGAAAAGCAACGAGCAAGAAGTCGTTGAGGCTGCAATCGAATCTGTTGCTGGTGAGCTAGAAGTGGAG
AGGAAGTTGAGGAGACGGTTTGAGAGCTTGAACAAGAAATTGGGCAAAGAATTGGCTGAAACAAAATCAGCTCTGATGAA
AGCAGTGAAAGAAATTGAGAACGAGAAGCGAGCGAGAGTGATGGTCGAGAAAGTATGTGATGAACTAGCAAGAGACATAA
GCGAAGACAAAGCCGAAGTTGAAGAACTGAAGAGAGAATCATTTAAAGTTAAAGAAGAAGTCGAAAAGGAAAGAGAGATG
TTGCAGTTAGCAGATGCATTGCGTGAAGAGAGAGTACAGATGAAACTCTCGGAGGCTAAACACCAGCTCGAGGAGAAAAA
CGCAACTGTTGATAAGCTAAGGAACCAGCTTCAAACTTACCTCAAAGCAAAAAGATGTAAAGAGAAGACCCGTGAACCGC
CTCAGACTCAGCTACAGAACGAAGAGACTGGAGATTATTTAAACCATCACATCGGTTTTGGATCATACAACATCGAAGAT
GGAGAAGTCGAGAATGGAAATGAAGAGGATTCAGGAGAAAGCGACCTTCATTCCATAGAACTGAACATAGACAACAAGAG
CTATAAATGGCCTTATGGTGAAGAAAACAGAGGAAGAAAATCAACGCCAAGGAAAAGCCTTTCTTTACAAAAAAGCATTT
CGGATTGTGTTGATTGGGTTGTACAGAGCGAGAAGCTTCAAAAAAGTGGAGATGGAGGATTGGATTGGGGAAGATCAATT
GAGGTTGAGCCTAAAGGGTATTTAGATGAAACACAAGCTTATAAACCAAACAAGGCTTCTTCAAAAGATCATCATCTCGT
CTCGGGTTCGAGACTAAGTAACTTCCGCGGTGGATCCGTTTCAAAGTCGCGGTTATCGGATGCCTCAAAAGGCGAAAACC
AGAATGCTAGAAAATCAAGATGGTAA