Details for Lyrate rockcress Locus 16045537

Position : sca3 ( 5`- 829376 .. 828014 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045537

Protein [Map View]
MEDPRISLFPSIYYRPIKPNDLDRLEQIHRDIFPIKYESEFFQCVVNGVDIISWAAVDRSRPDHHCDELIGFVTASSYCL
WFLIDDLIHYDSSKGEETLIYILTLGVVETYRNPMSLISEVINYASGLSVCQRSLPSCDCTQQCCDLLHGFYLIKRQHFD
AFLFVYFINGSRTPCSPLEVAMFVVNYMKSGIKLVASKLVNREEKGLKWLICKDTDCVLPSQTKPNLGSSSVYEFI*

DNA
ATGGAGGATCCACGAATCTCTCTCTTCCCAAGTATTTACTACAGACCTATAAAACCTAATGATCTAGATCGTTTGGAGCA
AATCCATCGCGACATCTTCCCCATCAAGTATGAGTCTGAGTTTTTTCAGTGTGTTGTGAACGGAGTTGATATCATCTCAT
GGGCTGCTGTTGATCGGAGCCGGCCTGATCATCACTGTGATGAACTTATTGGTTTTGTTACAGCGAGTTCATATTGCTTA
TGGTTTTTGATAGATGATCTTATTCATTACGATTCCTCAAAAGGAGAGGAGACTTTGATCTACATCTTGACACTCGGAGT
TGTGGAAACATACAGAAACCCAATGTCACTTATTAGTGAGGTGATTAATTATGCTTCTGGTTTATCGGTGTGTCAGAGGA
GTTTACCTTCATGTGATTGCACACAACAATGCTGCGATCTATTACACGGATTCTATCTAATCAAACGACAGCATTTTGAC
GCGTTCTTGTTTGTCTACTTCATCAACGGTTCTCGAACTCCTTGCTCACCCTTAGAGGTGGCGATGTTTGTTGTGAATTA
TATGAAGAGTGGCATCAAGTTAGTGGCATCTAAGCTGGTGAACAGGGAGGAGAAAGGTTTGAAATGGCTGATTTGCAAAG
ACACGGATTGCGTCTTACCCTCGCAAACCAAACCGAATCTCGGATCATCATCGGTGTACGAATTCATTTAA