Details for Lyrate rockcress Locus 16045516

Position : sca3 ( 5`- 10328909 .. 10329520 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16045516

Protein [Map View]
MKNQEIDFYQTPSDCSDEEIQRSCEFVKKVKELDDKTIIVKFVNAMKSYHYQSKSLSYIDLKTKVASILRNHDVLLQEFY
QLLLDLPITEKNCNSAKSDVERTVEFMNKVEALGKDLHGVFLNLFAFGGDIVTLIEQFDVIFRDHASLKEEFKAFLIDSR
ILKNPKRGFEAEVEESRYMAPSYKTRLEAEEELSSSILVNFHT*

DNA
ATGAAGAATCAGGAGATAGATTTTTATCAAACTCCGTCGGATTGTTCGGACGAAGAGATTCAACGAAGTTGCGAGTTTGT
GAAAAAAGTGAAAGAGTTGGATGATAAGACAATCATCGTTAAATTTGTCAATGCAATGAAGTCTTATCATTATCAATCTA
AGTCTTTAAGCTACATCGATCTCAAAACCAAAGTCGCTTCCATTCTTCGTAATCACGACGTTTTGCTCCAAGAATTCTAT
CAGCTTCTATTGGATTTACCTATCACGGAGAAGAATTGTAACTCGGCAAAATCAGACGTAGAACGCACGGTTGAGTTCAT
GAACAAAGTGGAAGCTTTGGGGAAGGATTTACACGGTGTGTTTCTAAATCTGTTTGCCTTTGGCGGTGATATAGTGACTT
TGATTGAACAATTCGACGTGATTTTCCGCGATCACGCATCTCTTAAAGAGGAGTTTAAAGCGTTTCTAATCGATTCCCGT
ATACTCAAAAACCCGAAACGTGGTTTTGAGGCGGAGGTTGAAGAGTCGAGGTACATGGCGCCGTCGTATAAGACTAGACT
TGAAGCTGAAGAGGAATTATCATCGTCTATTCTCGTCAATTTTCACACATAA