Details for Lyrate rockcress Locus 16045502

Position : sca3 ( 5`- 2775818 .. 2779410 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045502

Protein [Map View]
MDSTDDDFGDLYVDDAKVQASDASADDVGFVKSCKESECATNSSDFEGTVKPDLEGEMKKFDVVAKDSSPCDDDCAVNLT
EADEELEFSDSDSDDDLNIVLKDDDSKPLPAACVFNTNYGGSKACSFQRRWTRNASANNACIDPSLGMSQYGYSFSNPWS
RTPFDVNFDVFEKKPWRNPGMDTTDFFNFGLNEQSWKDYCKPLGRAIEVGGGTLERIPSADLRRPRDSDPGVVIQILVTN
DVEELSIMTPERARCITSNEASRSDDSHSNDRNDLNSVDDSPKDEAFVGCQEKNAASFSGEKSPPTENCCSREVTPSDKE
MLEEEKEEGFCNSDETDPSSVERESSLGDRIRLSPTSSCSAGKNEESDDYETESLKDSATDDQREVSTPPQQARLAEHEA
ISIKRGGNSGTMHSRPRRSHEDSSKRHCGRAGYAGYVKDASPTPDPGCGKKVRSRHGSLYRDSNKNWQKGPRVTLERDET
EGKGVHYYRENCHGRLYSSVDHAKHRKHRFGWRNIKESSLGRGFDHSNSYKCGAHPKEYTSRSSFDLNQRNSRSSFKEED
DRYGWHHCERKYGHERSPVRAYENYKERNGCNWLREPYYEDCIPITGMDYRYRSDYTSAHAIHNLNQSPENDIYCRRRGG
YDSNLHRHRYEDVVHRAESRIPFERAYREVRSFAEVEMREYQGYKRHEEFSEIEKRRHYTHDWNLDRFVSEKDDCKYRTQ
DDWSSPSLSLRDSWYTKEAKGDFWRDDARDFRTAEAYDNQNNQFHKAATRDGRTQNLGRSDNVSIKDRLKDDDDWVCPDR
GRYNTADDIQCSMREVTYSGHPSYTDEILRHIRENDERHHKSKKLRGDGHSFIKRQDPVDLAGRQGKRSNQSNKRFSNGE
QQDLQKPRKLVGKSEEKAMQTRDINDKEEGEIIEEATNVKGVEIDNERIQESLKKMEKRRERFKGTKMARTVEATFKSET
ERRAKTDVTNQQRPVRKRRWCAS*

DNA
ATGGATTCTACTGATGATGATTTCGGTGACTTGTACGTTGATGATGCCAAGGTTCAGGCCAGTGATGCTTCCGCCGACGA
TGTAGGATTCGTAAAATCGTGCAAAGAATCGGAATGTGCTACGAATTCCAGCGATTTTGAAGGGACGGTAAAACCTGATT
TGGAAGGTGAAATGAAGAAATTTGATGTTGTTGCTAAGGATTCGAGTCCGTGTGACGACGATTGTGCTGTGAATCTGACT
GAGGCCGATGAAGAATTGGAATTTAGTGACAGTGATAGTGATGATGATTTGAATATAGTGCTCAAAGACGACGATTCTAA
ACCCCTTCCTGCTGCTTGTGTCTTTAACACCAACTATGGCGGATCCAAAGCTTGCTCGTTTCAGAGACGGTGGACTAGAA
ACGCTTCAGCTAATAACGCTTGCATTGATCCGTCTTTAGGAATGTCTCAATATGGATATAGTTTCTCAAACCCTTGGTCC
AGGACACCTTTTGACGTAAATTTCGATGTGTTTGAGAAGAAGCCATGGAGGAATCCTGGTATGGATACTACTGACTTCTT
TAATTTTGGCTTGAACGAGCAAAGCTGGAAAGATTACTGTAAACCGTTGGGAAGAGCAATTGAGGTTGGAGGTGGAACTC
TTGAGCGAATACCTTCTGCAGATTTGCGTCGTCCACGTGATTCAGACCCTGGCGTGGTGATACAGATCCTTGTTACTAAT
GATGTTGAGGAGCTATCAATCATGACACCTGAGAGAGCAAGGTGCATAACATCAAATGAAGCATCTAGAAGTGACGATTC
TCATTCAAATGACAGGAATGATTTGAATTCAGTCGATGATTCTCCAAAAGATGAAGCTTTTGTGGGCTGTCAAGAAAAAA
ACGCTGCAAGTTTCAGTGGCGAGAAATCTCCTCCAACAGAGAATTGCTGCAGTAGGGAAGTGACACCTAGTGATAAGGAA
ATGCTCGAGGAGGAGAAAGAAGAGGGTTTTTGCAATTCTGATGAGACGGATCCATCCTCAGTGGAGAGGGAATCATCTCT
TGGAGATCGCATTCGTTTGAGCCCTACCTCTTCTTGCTCTGCTGGTAAAAATGAGGAATCTGATGATTATGAAACAGAGT
CATTGAAAGACAGTGCTACTGATGACCAACGTGAAGTCAGTACCCCACCACAACAAGCTAGACTTGCAGAACATGAAGCA
ATTAGTATCAAAAGAGGGGGAAATAGTGGCACAATGCATTCTAGACCCAGAAGATCTCACGAAGATTCAAGCAAAAGGCA
CTGTGGGAGAGCTGGCTATGCTGGCTATGTTAAGGATGCATCGCCTACACCAGATCCTGGTTGTGGCAAGAAAGTTCGTT
CTCGACATGGAAGTTTGTATCGTGATTCAAACAAAAACTGGCAGAAGGGACCACGTGTTACATTAGAAAGGGATGAAACT
GAAGGTAAAGGCGTTCATTACTATAGAGAGAATTGTCATGGTAGATTGTATTCATCTGTGGATCATGCTAAGCATAGAAA
GCACAGGTTTGGTTGGCGCAACATCAAAGAATCATCACTGGGTCGAGGTTTTGATCATTCTAATAGTTACAAGTGTGGGG
CGCATCCTAAAGAGTATACCTCACGTTCATCCTTCGATCTTAATCAGAGAAATTCTAGATCAAGTTTTAAAGAAGAGGAT
GATCGATATGGTTGGCATCATTGTGAAAGAAAATATGGTCATGAAAGAAGTCCTGTCCGCGCCTACGAAAACTACAAAGA
AAGAAATGGGTGCAATTGGCTAAGAGAACCTTATTATGAGGACTGTATACCGATTACTGGCATGGATTATAGGTACCGGT
CAGATTACACTTCTGCACATGCAATACACAACCTCAATCAGAGTCCAGAGAATGATATTTATTGCAGAAGAAGGGGTGGA
TACGATTCTAATTTGCATCGCCATAGATATGAAGATGTAGTTCACAGGGCAGAAAGTAGAATTCCATTTGAGCGGGCTTA
CAGAGAGGTGCGTTCTTTTGCTGAAGTGGAAATGAGAGAATATCAAGGGTATAAAAGGCATGAGGAATTCTCTGAAATAG
AGAAAAGACGCCATTACACTCATGATTGGAATCTTGATAGATTTGTCTCAGAGAAAGATGATTGTAAGTATAGAACCCAA
GATGATTGGTCCTCACCGTCTTTATCTTTGAGAGATTCTTGGTATACCAAAGAAGCAAAAGGTGATTTCTGGAGAGATGA
TGCTAGAGACTTTAGAACAGCTGAAGCATATGACAACCAGAATAACCAGTTTCATAAGGCTGCAACGAGAGATGGTCGGA
CGCAGAATCTTGGTCGTAGTGATAATGTGAGCATAAAAGATAGACTAAAGGATGATGATGATTGGGTTTGTCCTGATAGA
GGAAGATATAATACGGCAGATGACATTCAATGTTCAATGAGAGAAGTTACTTATTCTGGGCATCCATCATATACTGATGA
GATATTAAGGCATATTCGTGAAAATGATGAGAGACATCACAAATCCAAGAAGCTGAGAGGAGATGGGCATTCTTTCATCA
AGCGTCAGGATCCAGTTGACTTAGCTGGTAGGCAAGGAAAGCGCTCAAACCAATCAAACAAAAGATTCTCCAATGGCGAG
CAACAAGATCTTCAAAAACCAAGAAAGTTAGTGGGCAAAAGCGAAGAGAAAGCTATGCAGACTCGAGATATAAATGACAA
AGAAGAAGGCGAGATCATAGAAGAAGCGACGAACGTGAAAGGTGTAGAAATAGACAATGAGCGTATACAAGAGAGCCTGA
AGAAGATGGAGAAACGGAGGGAGAGGTTCAAGGGAACCAAAATGGCGAGGACGGTAGAAGCCACATTCAAATCTGAAACG
GAAAGGAGAGCTAAAACCGATGTTACTAATCAACAGAGACCGGTTAGAAAGAGGAGATGGTGTGCAAGTTAG