Details for Lyrate rockcress Locus 16045499

Position : sca3 ( 5`- 2883602 .. 2908497 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045499

Protein [Map View]
MVGFARTKFCKHLSSLSDNGENHEKPYTFEGNRQIVNDICNVLETGAWGPSAENALSALNFKPQPEFVIGVLRRLKDVNR
AIEYFRWYERRTELPHCPESYNSLLLVMARCRNFDALDQILGEMSVAGFGPSVNTCIEMVLSCVKANKLREGFDVVQNMR
KFKFRPAFSAYTTLIGAFSAVNHSDMMLTLFQQMQELGYEPTVHLFTTLIRGFAKEGRVDSALSLLDEMKSSSLDADIVL
YNVCIDSFGKVGKVDMAWKFFHEIEANGLKPDEVTYTSMIGVLCKANRLDEAVEMFEHLEKNRRVPCTYAYNTMIMGYGS
AGKFDEAYSLLERQRAKGSIPSVIAYNCILTCLRKMGKVDEALRVFEEMKKDAAPNLSTYNILIDMLCRAGKLDCAFELR
DSMQKAGLFPNVRTVNIMVDRLCKSQKLDEACAIFEQMDYKVCTPDEITFCSLIDGLGKVGRVDDAYKIYEKMLDSDCRT
NSIVYTSLIKNFFNHGRKEDGHKIYKDMVNQNCSPDLQLLNTYMDCMFKAGEPEKGRAMFEEIKSRRFVPDARSYSILIH
GLIKAGFANETYELFYSMKEQGCVLDTRAYNIVIDGFCKCGKVNKAYQLLEEMKTKGFEPTVVTYGSVIDGLAKIDRLDE
AYMLFEEAKSKRIELNVVIYSSLIDGFGKVGRIDEAYLILEELMQKGLTPNVYTWNSLLDALVKAEEINEALVCFQSMKE
LKCTPNQVTYGILINGLCKVRKFNKAFVFWQEMQKQGMKPSTISYTTMISGLAKAGNIAEAGALFDRFKANGGVPDSACY
NAMIEGLSNGNRAMDAFSLFEETRRRGLHIHNKTCVVLLDTLHKNDCLEQAAIVGAVLRETGKARHAARSW*

DNA
ATGGTGGGATTCGCAAGAACAAAATTTTGTAAGCACTTATCATCTTTGTCTGATAATGGCGAAAATCATGAGAAACCATA
TACATTTGAGGGTAATAGGCAAATTGTTAATGATATTTGCAATGTTTTGGAGACTGGTGCTTGGGGTCCTTCAGCTGAGA
ATGCTCTATCTGCTCTAAACTTTAAACCACAACCAGAATTTGTCATTGGGGTTTTACGGAGGCTGAAAGATGTTAATCGG
GCGATTGAGTATTTCCGTTGGTATGAGAGAAGAACCGAGCTGCCTCATTGTCCCGAATCATACAACTCCTTGCTTTTAGT
GATGGCTCGTTGTAGGAATTTTGATGCTTTGGACCAGATTCTTGGAGAAATGAGTGTTGCAGGATTTGGCCCTTCTGTTA
ACACTTGTATTGAGATGGTTTTGAGCTGCGTTAAGGCTAATAAGCTTAGGGAAGGTTTTGATGTTGTGCAGAATATGAGG
AAGTTCAAGTTCCGACCTGCTTTTTCAGCTTACACAACTCTTATCGGTGCTTTCTCAGCAGTTAATCATTCTGATATGAT
GTTGACACTCTTTCAGCAAATGCAGGAGTTAGGATATGAGCCAACCGTTCATCTTTTTACAACATTGATTCGGGGCTTTG
CCAAAGAGGGTCGAGTTGATTCTGCTCTATCTTTGCTTGATGAGATGAAGAGCAGCTCTCTTGATGCCGACATTGTTCTT
TACAATGTATGTATAGATAGCTTTGGTAAAGTGGGCAAGGTTGATATGGCATGGAAATTTTTTCATGAGATTGAAGCGAA
TGGTTTAAAGCCTGATGAAGTCACTTATACCAGCATGATAGGAGTTCTGTGCAAGGCAAATAGATTGGATGAAGCTGTAG
AGATGTTTGAGCATTTAGAGAAGAATAGACGGGTCCCTTGCACTTATGCTTACAACACGATGATTATGGGTTATGGTTCG
GCTGGAAAATTTGATGAAGCATACAGTCTCCTAGAGAGACAAAGGGCAAAAGGGTCTATACCGAGTGTGATTGCATATAA
TTGCATTCTTACATGCTTAAGGAAAATGGGAAAAGTGGATGAAGCTTTGAGAGTATTCGAGGAGATGAAAAAAGACGCTG
CTCCAAATCTTTCAACCTATAATATTCTCATTGACATGCTGTGTAGAGCTGGTAAACTTGACTGTGCTTTTGAGCTACGC
GATTCTATGCAGAAGGCTGGTCTGTTTCCTAATGTTAGGACTGTGAACATAATGGTTGATCGTCTCTGTAAATCCCAAAA
ACTTGATGAAGCATGTGCTATATTTGAGCAGATGGATTATAAGGTTTGTACCCCAGATGAGATTACATTTTGCTCCCTCA
TAGATGGCTTAGGAAAGGTCGGAAGAGTTGATGACGCTTACAAAATCTATGAGAAGATGTTAGATTCTGATTGTCGTACT
AACTCTATTGTTTACACATCCCTCATAAAAAACTTCTTCAACCACGGTAGAAAGGAAGATGGACACAAGATATACAAGGA
CATGGTTAATCAAAACTGTTCTCCTGATTTACAGCTTCTTAATACGTACATGGATTGCATGTTCAAGGCTGGAGAACCAG
AAAAGGGAAGGGCGATGTTTGAAGAAATAAAATCCCGTCGGTTTGTCCCAGATGCTCGAAGCTACTCGATTTTAATTCAT
GGACTAATAAAAGCAGGATTTGCAAATGAAACTTATGAGTTGTTTTATTCCATGAAAGAGCAAGGCTGTGTCTTGGACAC
CCGTGCTTACAATATTGTCATTGACGGTTTCTGCAAGTGCGGAAAAGTGAACAAAGCTTATCAGCTGCTGGAGGAAATGA
AGACAAAAGGTTTTGAGCCAACTGTCGTTACGTATGGGTCAGTCATTGACGGGCTAGCAAAAATAGATCGGCTTGATGAA
GCTTATATGCTCTTTGAGGAAGCAAAATCAAAGAGAATAGAGCTAAATGTGGTAATTTACAGTAGTCTAATTGATGGGTT
TGGAAAAGTTGGTAGGATAGATGAAGCTTACCTTATCTTGGAAGAGCTTATGCAGAAAGGATTAACACCTAATGTTTATA
CATGGAACTCATTGCTTGATGCATTGGTCAAAGCTGAGGAAATCAATGAAGCGCTTGTCTGTTTTCAGTCGATGAAAGAA
TTGAAATGCACGCCAAACCAAGTTACTTATGGTATCCTAATAAATGGTCTTTGTAAGGTCAGGAAGTTCAATAAAGCCTT
TGTCTTTTGGCAAGAGATGCAGAAACAGGGGATGAAACCTAGCACTATTTCTTACACCACCATGATATCGGGGCTTGCAA
AGGCTGGGAATATTGCAGAGGCTGGGGCGCTCTTTGATCGGTTTAAGGCAAACGGTGGTGTTCCAGACTCTGCTTGTTAT
AATGCCATGATCGAAGGTCTAAGTAACGGAAACAGGGCAATGGATGCTTTTTCTCTTTTTGAGGAAACACGTCGAAGAGG
ATTACATATCCATAATAAAACATGTGTTGTTCTTTTGGATACTTTGCATAAGAATGATTGTCTTGAGCAAGCAGCTATTG
TTGGAGCTGTTTTGAGGGAAACGGGAAAGGCACGGCATGCTGCACGATCTTGGTAG