Details for Lyrate rockcress Locus 16045479

Position : sca3 ( 5`- 6568507 .. 6566437 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045479

Protein [Map View]
MYSLSRILRRSRRYNFASSSFGAVSKLEVSSSGGDKERVFKSSGLIYNKSQGLIRLYSTRDVFSRFFGIHKLSSIADAKD
KGDEVVREEELSESEEAFPVSGDVSEGVVDDDSLFESEVASDNDGLEIEGGKPTKKRAQSELYESIVAYKSVKHVLEKWV
KEGKDLSQAEVSLAIFHLRKRKYYAMCLQLWEWLGANTQFEFTEANYASQLDLVAKVHSLQKAENFLKDIPESFRGEVVY
RTLLANCVLKHHVNKAEDLFNKMKELKFPTSVFACNQLLLLYSMHDRKKISDVLLLMERENIKPSRGTYQFLINSKGLAG
DITGMEKIVETMKEEGIEVDPELQATLAKYYIRAGLKERAQDLMKEIEGKGLQQTPWVCRSLLPLYADIGDSDNVRRLST
FVDQNLRYDNCISAIRAWGKLKEVEEAEAVFERLVEKYKIFPMLPYFALMEIYTENKMLAKGKDLVKRMGNAGVTIGPST
WHALVKLYIKAGEVGKAELILNRATKDNKMRPMFISYMAILEEYAKRGDVHNTEKVFMKMKRASYAAQLMQYETVLLAYI
KAKTPAYGMFERMKADNVFPNKSLAAKLAQVNPFKKCPVSVLLDE*

DNA
ATGTATTCGCTTTCGAGGATTCTCCGAAGGAGTCGAAGATATAACTTTGCATCTTCCTCGTTTGGTGCGGTCAGTAAATT
AGAAGTATCATCAAGTGGTGGTGACAAAGAAAGGGTCTTTAAATCATCTGGACTGATTTATAATAAATCTCAAGGTTTAA
TCAGACTTTATTCCACAAGAGATGTGTTTTCACGGTTCTTTGGTATCCATAAGCTTTCTTCTATAGCTGATGCTAAAGAC
AAAGGAGATGAGGTAGTAAGGGAAGAGGAGTTGTCTGAATCAGAGGAGGCGTTTCCTGTTTCTGGGGATGTATCAGAGGG
AGTTGTTGATGATGATTCTTTGTTCGAGTCTGAGGTTGCTAGTGACAATGATGGTCTTGAAATTGAAGGTGGGAAACCAA
CAAAGAAAAGAGCTCAATCTGAGCTATATGAATCCATTGTTGCCTATAAATCAGTGAAACATGTTCTTGAAAAATGGGTC
AAAGAAGGAAAAGATTTGAGTCAAGCTGAGGTTTCTCTTGCTATATTCCATCTGCGTAAACGTAAATACTATGCTATGTG
TTTACAGTTGTGGGAGTGGTTGGGAGCTAATACGCAGTTTGAGTTCACAGAGGCAAATTATGCTTCTCAACTGGATTTGG
TGGCCAAGGTACATAGTTTACAAAAAGCTGAAAACTTTTTGAAGGATATTCCAGAATCTTTCAGGGGAGAAGTGGTATAC
AGAACCCTGCTGGCAAATTGTGTACTTAAGCATCATGTAAATAAAGCTGAAGATCTTTTTAATAAAATGAAAGAACTAAA
ATTTCCAACAAGCGTGTTTGCTTGCAACCAGCTGCTTCTCCTCTACAGTATGCATGATAGAAAGAAGATAAGTGATGTTT
TGTTGCTAATGGAGAGAGAAAACATCAAGCCGAGTCGTGGTACGTATCAGTTTTTAATCAATAGTAAAGGTTTAGCCGGG
GACATAACTGGAATGGAGAAGATCGTGGAGACAATGAAGGAAGAAGGTATCGAAGTAGATCCAGAACTGCAGGCTACTCT
GGCTAAGTACTACATAAGAGCGGGGCTTAAAGAACGAGCACAAGACCTTATGAAGGAGATAGAAGGGAAAGGTTTGCAAC
AAACTCCATGGGTGTGCCGGTCATTACTCCCACTTTATGCAGACATAGGAGACAGTGACAATGTGAGAAGACTGAGTACG
TTTGTTGATCAAAATCTGAGATATGATAATTGCATTTCTGCTATTAGAGCATGGGGAAAGCTGAAGGAAGTGGAAGAAGC
AGAGGCAGTGTTTGAGAGACTTGTGGAGAAATACAAAATTTTCCCTATGCTGCCATATTTTGCCCTCATGGAGATATACA
CAGAGAACAAGATGCTAGCAAAAGGCAAAGATCTGGTTAAAAGAATGGGAAATGCAGGGGTTACGATTGGCCCGTCGACA
TGGCACGCTCTTGTGAAGCTATACATCAAAGCGGGAGAAGTTGGAAAAGCTGAGTTGATATTGAACAGAGCTACAAAGGA
TAATAAGATGAGACCTATGTTCATTTCTTACATGGCGATTCTCGAGGAATATGCAAAAAGAGGCGATGTTCATAACACAG
AGAAGGTATTCATGAAAATGAAAAGGGCAAGCTATGCAGCTCAGCTTATGCAGTATGAAACCGTTCTGTTGGCTTATATC
AAAGCCAAAACTCCTGCTTACGGGATGTTTGAGAGGATGAAGGCAGATAATGTGTTCCCAAACAAGAGTCTTGCTGCGAA
ACTGGCTCAGGTTAATCCATTTAAAAAGTGTCCAGTGTCTGTTTTACTTGACGAATGA