Details for Lyrate rockcress Locus 16045450

Position : sca5 ( 5`- 17963885 .. 17961972 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_486092 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16045450

Protein [Map View]
MQTEESHDLTNGISEEESKETKKSQKADRKKKKLKEKLLKEASKADNRGVCYLSRIPPHMDHVRLRHILAQFGELGRIYL
APEDSEAQVHRKRAGGFRGQRFSEGWVEFAKKSVAKRVADMLNGEQIGGKKKSSVYYDIWNIKYLTKFKWDDLTEEIAYK
SAIREQKLNMVLSAAKREKDFYLSKIEKSRAMTEIDARMKKKRKIQEESGSNAEAAPVFPPRVIRHFRQKKSIENETSQS
KPGLSTDFLASVFGGS*

DNA
ATGCAGACTGAGGAATCTCACGACCTTACGAATGGAATCTCCGAGGAGGAGTCGAAGGAAACAAAGAAGAGTCAAAAGGC
TGATAGAAAGAAAAAGAAGTTGAAAGAGAAATTGCTTAAGGAAGCTTCTAAAGCTGACAATAGAGGGGTTTGCTACTTAA
GTCGTATCCCACCACATATGGATCACGTTAGACTTCGCCATATTCTCGCTCAATTTGGAGAATTAGGAAGGATTTATCTT
GCACCTGAAGATTCTGAAGCACAAGTTCACCGCAAGCGTGCTGGTGGATTTCGTGGGCAAAGGTTTTCTGAAGGGTGGGT
GGAGTTTGCTAAGAAAAGCGTAGCTAAACGGGTTGCAGATATGCTAAATGGAGAACAAATCGGGGGGAAAAAGAAGTCAT
CAGTATATTATGATATTTGGAACATCAAATACTTGACCAAATTTAAATGGGATGATCTTACTGAAGAAATCGCATACAAA
AGCGCAATACGGGAACAGAAATTAAATATGGTTCTTTCTGCTGCAAAGAGGGAGAAGGACTTTTATCTATCTAAAATAGA
GAAGTCACGTGCCATGACCGAGATAGATGCACGAATGAAAAAGAAACGAAAGATTCAGGAAGAATCGGGTAGCAATGCTG
AAGCAGCACCAGTCTTTCCACCTAGGGTGATTCGCCATTTTAGACAGAAGAAATCAATTGAAAATGAGACATCTCAGAGC
AAGCCTGGGCTCTCCACTGATTTCCTAGCATCGGTATTTGGCGGTTCTTAA