Details for Lyrate rockcress Locus 16045444

Position : sca3 ( 5`- 4595286 .. 4593130 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478482 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16045444

Protein [Map View]
MPSRRSESAVKLITYSEELEDGKPFVAFSNCLPVKALNREPAGHAFHSAALKLHGCAEEPTDDEGVDKKVGDDKEKEYVP
SFNSYANKGKKKSGTQQQDHYALLGLSNLRYLATEDQIRKSYREAALKHHPDKLATLLLAEETEEAKEAKKDEIESRFKA
IQEAYEILMDPTRRRIFDSTDEFDDEVPSDCLPQDFFKVFGAAFKRNARWSVNQRIPDLGDENTTLKDVDKFYNFWYAFK
SWREFPDEEEHDLEQADSREERRWMEKENAKKTVKARKEEHARIRTLVDNAYRKDPRIVKRKEEEKAEKQQKKEAKLLAK
KKQAEDAAIAAEEEKRRKEEEEKRAAESAQQQKKTKEKEKKLLRKERNRLRTLSAPLVAQRLLGISEEDIENLCMSLNTE
QLQNLYGCDSSRNDEAESKEKESKKTNGGTEPTPQVSQLDSSTQKKQPWSKEEIDMLRKGMIKYPKGTSRRWEVVSEYIG
TGRSVEEILKATKTVLLQKPDSAKAFDSFLEKRKPSASISSPLSTREELGESLPTVTTTANAKPSKETVVGKSSSSQSSD
NNGEVGGSSDADSWSTVQERALVQALKTFPKETSQRWERVAAAVPGKTMNQCKKKFAELKEIIRNKKTGV*

DNA
ATGCCGAGCCGGAGAAGTGAGTCTGCCGTTAAGCTTATTACATACTCTGAGGAGCTTGAGGATGGAAAACCGTTCGTTGC
TTTTTCCAATTGTCTTCCTGTGAAGGCTTTAAACCGTGAACCTGCTGGTCATGCCTTCCATTCTGCTGCTCTTAAACTGC
ATGGTTGTGCAGAAGAACCCACAGACGATGAAGGTGTTGATAAGAAAGTGGGAGATGATAAAGAGAAGGAATATGTTCCT
TCATTCAACTCGTATGCCAACAAAGGAAAAAAGAAGTCTGGTACCCAGCAACAAGACCACTATGCCTTGTTGGGTTTGAG
CAATTTAAGATATCTTGCGACAGAAGATCAGATTAGGAAAAGCTATCGTGAAGCTGCGCTGAAGCATCATCCTGATAAAC
TCGCTACTCTCCTTCTTGCAGAGGAAACAGAAGAAGCCAAGGAGGCAAAAAAAGATGAGATAGAATCTCGCTTCAAAGCG
ATTCAAGAAGCATATGAGATATTGATGGACCCAACAAGGAGAAGAATTTTTGACTCCACTGATGAGTTTGATGACGAGGT
TCCATCAGATTGCTTGCCGCAAGACTTTTTCAAGGTGTTTGGTGCAGCTTTTAAAAGAAATGCTAGGTGGTCAGTGAATC
AGCGTATTCCAGATTTGGGAGATGAAAACACAACACTTAAAGATGTTGATAAGTTCTACAATTTTTGGTACGCTTTCAAG
AGTTGGAGGGAATTTCCTGATGAAGAGGAGCATGATCTTGAACAAGCAGATTCCCGTGAAGAACGGAGGTGGATGGAGAA
GGAGAATGCAAAAAAAACTGTGAAGGCTAGAAAGGAGGAGCATGCTCGAATCCGGACTCTTGTTGACAATGCGTATAGAA
AAGACCCGAGAATTGTGAAAAGAAAAGAGGAAGAAAAGGCCGAGAAGCAACAGAAAAAAGAAGCAAAGCTTCTGGCCAAG
AAGAAGCAGGCAGAGGACGCTGCTATTGCTGCTGAAGAAGAGAAAAGGCGAAAAGAAGAAGAAGAAAAGCGAGCAGCAGA
ATCTGCACAACAACAAAAGAAAACTAAGGAAAAAGAGAAGAAGCTCTTACGCAAAGAACGTAATCGTCTTAGAACTCTCT
CAGCTCCTCTCGTGGCTCAGCGTCTGCTTGGCATCTCCGAGGAAGATATAGAGAATCTATGCATGTCACTAAACACCGAG
CAGTTGCAGAATCTATATGGATGCGACAGTAGTAGAAACGACGAAGCCGAATCTAAAGAAAAAGAAAGTAAGAAGACCAA
CGGTGGCACAGAGCCTACACCCCAAGTTTCTCAATTAGATAGTAGCACTCAGAAGAAACAACCATGGAGCAAGGAAGAGA
TTGATATGCTGAGAAAAGGAATGATAAAATATCCAAAGGGGACATCTAGAAGATGGGAAGTTGTTTCAGAGTACATTGGT
ACAGGAAGATCCGTAGAGGAGATTCTGAAAGCAACTAAAACAGTTCTTCTCCAAAAACCAGATTCAGCTAAAGCATTCGA
TTCTTTCCTCGAGAAGAGGAAACCCTCTGCTTCAATCTCATCCCCCCTCTCCACAAGAGAGGAGCTCGGAGAATCTCTGC
CCACGGTGACTACCACGGCAAATGCAAAACCCTCTAAAGAGACTGTCGTGGGGAAGAGCTCGAGCAGTCAAAGCTCAGAC
AACAATGGTGAAGTAGGTGGAAGTTCAGACGCAGATAGTTGGTCAACTGTGCAAGAAAGAGCTTTGGTTCAAGCTTTAAA
GACATTCCCGAAAGAGACAAGCCAAAGATGGGAGAGAGTAGCTGCAGCTGTTCCTGGTAAAACGATGAACCAATGCAAGA
AGAAGTTTGCAGAGCTCAAGGAAATCATTAGAAACAAGAAAACCGGAGTCTGA