Details for Lyrate rockcress Locus 16045413

Position : sca3 ( 5`- 1332901 .. 1334073 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045413

Protein [Map View]
MADSWKEIGSRCHHCAGPLTKNLETNEWTVAPFIRDSFSMIGSAVGGTASAFIGFNHVMPIVRKWIKGPMWLHFLVGAPP
VIVVSSACAGLAGGAVPALAQLASSSYHAAVHSSQPPQGQEKNKLHKSSTISPS*

DNA
ATGGCGGATTCATGGAAGGAGATCGGATCTAGATGTCATCATTGCGCAGGCCCTCTTACGAAAAATCTGGAAACTAACGA
ATGGACTGTGGCTCCGTTTATCAGGGATAGCTTCTCTATGATTGGATCAGCTGTAGGTGGTACTGCAAGTGCTTTCATTG
GATTTAACCATGTAATGCCAATTGTACGCAAGTGGATAAAAGGACCCATGTGGTTGCATTTTCTTGTTGGTGCTCCACCT
GTGATAGTTGTTTCATCAGCCTGTGCTGGACTTGCAGGTGGCGCTGTACCGGCTTTGGCACAGCTTGCATCGTCGTCTTA
TCATGCGGCTGTACATTCATCTCAGCCACCGCAAGGGCAAGAGAAGAACAAATTGCACAAATCCTCTACCATTTCTCCTT
CGTAG