Details for Lyrate rockcress Locus 16045387

Position : sca3 ( 5`- 8495896 .. 8497989 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479481 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16045387

Protein [Map View]
MRGGARADEFNFNTNPSTPNTGQPTPMYPAGVVGGGGRKKGVGVRSWLVLDSSGKSDLKEEGKHSIMRRTGLPARDLRIL
DPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLLLNSKDPSVSPFIDELQRRILCHHHATKPQEEQKSEGELHSRTDPA
QGEAGTPQSSGDQGSEAKKDAKQSLENQDGSKVLPFEFVALEACLEAASSSLEHEALRLELEAHPALDKLTSKISTLNLE
RVRQIKSRLVAITGRVQKVRDELEHLLDDDEDMAEMYLTEKLAQKLEDSSNSSMNESDTFEVDLPQGDEDDRLPPEFASL
ANRDERYLQGTDAHHLLMSAHSALSRNSRGTHTSSTRSAMTNKLDVEELEMLLEAYFVQIDGILNKLSTLREYVDDTEDY
INIMLDDKQNHLLQMGVMLTTATLVMSAFIAVAGVFGMNITIELFKDNEAGPRRFIWTVIGGSVGSIFLYVGAIGWCKYK
RLLE*

DNA
ATGAGAGGAGGAGCTAGAGCCGATGAATTCAATTTCAATACGAATCCATCAACGCCAAACACTGGTCAGCCGACACCGAT
GTACCCCGCCGGTGTTGTGGGTGGCGGCGGACGGAAGAAAGGCGTTGGCGTGAGGTCGTGGTTGGTACTGGACTCGTCAG
GGAAGTCGGATCTAAAGGAAGAAGGGAAACACTCCATCATGCGGCGAACAGGATTGCCGGCGAGAGATCTTCGGATTCTC
GATCCACTGTTGTCGTATCCATCTACTGTTTTAGGTAGAGAGAGAGCGATTGTCATCAATTTGGAGCATATCAAGGCAAT
CATCACCGCTCAAGAAGTTTTGTTGCTCAATTCCAAGGATCCTTCCGTGTCACCCTTTATCGATGAGTTGCAGAGGCGGA
TTCTCTGTCACCATCACGCCACTAAACCTCAGGAGGAACAGAAATCTGAGGGAGAGCTTCATTCGAGGACAGATCCTGCC
CAAGGAGAAGCTGGAACGCCACAATCATCTGGGGATCAAGGGAGTGAAGCCAAGAAGGATGCAAAGCAAAGTCTTGAGAA
TCAAGATGGATCTAAGGTTCTTCCATTTGAGTTTGTTGCTTTGGAAGCCTGTCTTGAAGCTGCATCAAGCAGTTTGGAAC
ATGAGGCCTTAAGATTGGAGTTAGAGGCTCATCCAGCCCTGGACAAGCTTACTTCCAAGATCAGTACCCTTAATTTGGAG
CGGGTTCGACAGATTAAAAGCAGGCTGGTTGCAATAACTGGACGTGTTCAGAAGGTTAGGGACGAGCTAGAACATCTGCT
AGACGATGATGAAGATATGGCTGAGATGTATCTTACGGAGAAGTTAGCTCAGAAACTTGAGGATTCGTCAAATTCTTCTA
TGAATGAGAGTGATACATTCGAGGTTGATCTTCCTCAAGGAGACGAGGATGACAGGCTTCCTCCTGAATTTGCATCGTTG
GCTAACAGAGATGAAAGATATCTACAAGGAACTGATGCTCACCATCTTCTTATGAGTGCTCACAGTGCACTTAGCAGAAA
TAGCCGTGGGACTCATACAAGCTCAACGAGGAGTGCCATGACCAACAAATTAGATGTGGAAGAGCTTGAAATGCTTTTGG
AAGCATATTTCGTGCAGATCGATGGTATACTGAACAAACTATCAACACTAAGGGAATATGTGGATGACACGGAGGACTAC
ATCAACATAATGCTAGATGACAAGCAGAATCATCTTCTGCAGATGGGTGTGATGCTAACAACAGCTACTCTGGTGATGAG
CGCCTTTATCGCAGTTGCTGGTGTATTTGGTATGAATATTACGATAGAGTTGTTCAAGGATAATGAAGCTGGTCCAAGAA
GATTCATTTGGACTGTAATTGGAGGTTCTGTCGGCAGTATATTCCTCTACGTAGGTGCCATCGGGTGGTGCAAGTACAAG
CGCCTTCTTGAATGA