Details for Lyrate rockcress Locus 16045385

Position : sca3 ( 5`- 10933239 .. 10940310 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_898886 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16045385

Protein [Map View]
MTVSGDSSETVSTDMIFEPILEHGVFRFDSSVDHRKAVFPSVSFKNSKDREVPIVSHSVPAYIPTSVCLQDQQVVTFEFS
PGTSFYGTGEVSGQLERTGKRVFTWNTDAWGYGSGTTSLYQSHPWVLVVLPTGETLGVLADTTRKCEIDLRKEGIIRIIS
PTSYPIITFGPFSSPTAVLESLSHAIGTVFMPPKWALGYHQCRWSYMSDKRVAEIAQTFRDKKIPSDVIWMDIDYMDGFR
CFTFDKERFPDPSALTKDLHSNGFKAIWMLDPGIKQEEGYYVYDSGSKNDVWISRADGKPFIGEVWPGPCVFPDYTNSKA
RSWWANLVKEFVSNGVDGIWNDMNEPAVFKVVTKTMPENNIHRGDDDLGGVQNHSHYHNVYGMLMARSTYEGMELADKNK
RPFVLTRAGFIGSQRYAATWTGDNLSNWEHLHMSISMVLQLGLSGQPLSGPDIGGFAGNATPRLFGRWMGVGAMFPFCRG
HSEAGTADHEPWSFGEECEEVCRAALKRRYQLLPHFYTLFYIAHTTGAPVAAPIFFADPKDSRLRTVENGFLLGPLLLYA
STLSSQGSHELQHILPRGIWLRFDFEDSHPDLPTLYLQGGSIISLAPPHLHVGEFSLSDDLTLLVSLDENGKAKGLLFED
DGDGYGYTKGRFLVTHYIAERHSSTVTVKVSKTEGDWQRPKRRIHVQLLLGGGAMLDAWGMDGEIIHIKVPSESEVSELI
STSNERFKLHMENTKLIPEKEVLPGQKGMELSKEPVELNSGDWKLNIVPWIGGRILSMTHVPSGIQWLHSRIDINGYEEY
SGTEYRSAGCTEEYNVIERDLEHAGEEESLILEGDVGGGLVLRRKISIPKENPRVFQIASSIEARSVGAGSGGFSRLVCL
RVHPTFTLLHPTESFVSFMSIDGSKHEVWPDSEEQIYEGNNLPHGEWMLVDKSLNLRLVNKFNVSQVFKCIVHWDCGTVN
LELWSEDRPVSKESPLKIEHEYEVASFP*

DNA
ATGACTGTAAGTGGAGATAGCTCGGAAACTGTTTCAACCGATATGATTTTCGAGCCGATTTTGGAGCACGGAGTTTTCCG
GTTTGACTCTTCTGTGGACCATAGGAAGGCTGTATTTCCTAGTGTTTCATTTAAGAACAGCAAAGACCGGGAAGTTCCAA
TTGTGAGTCACAGTGTTCCAGCATATATTCCTACTAGTGTTTGTCTTCAGGACCAACAAGTTGTCACTTTTGAGTTTTCT
CCTGGCACATCGTTTTATGGAACGGGAGAAGTTAGTGGTCAGTTGGAGAGAACAGGGAAACGGGTTTTTACTTGGAACAC
TGATGCTTGGGGATATGGCTCTGGAACCACTTCGTTATACCAGTCACATCCTTGGGTACTAGTTGTCCTTCCAACCGGAG
AAACACTAGGGGTTCTTGCTGACACAACACGAAAGTGTGAGATTGATCTAAGGAAAGAGGGAATCATAAGAATTATCTCC
CCAACATCATATCCAATAATCACATTTGGTCCATTCTCCTCACCCACTGCTGTCTTGGAGTCCCTATCGCACGCCATTGG
AACTGTTTTTATGCCTCCAAAGTGGGCCTTAGGCTACCACCAATGCCGTTGGAGTTATATGTCTGACAAGCGAGTAGCTG
AGATCGCTCAAACATTTCGTGACAAGAAAATTCCTTCTGACGTGATATGGATGGATATTGACTACATGGATGGTTTTCGT
TGTTTCACATTCGACAAGGAGCGTTTCCCGGATCCAAGTGCTTTGACGAAAGATCTCCATAGCAATGGTTTCAAAGCGAT
CTGGATGCTTGACCCTGGAATAAAGCAGGAGGAAGGTTATTATGTCTATGATAGTGGGAGTAAAAATGATGTTTGGATTA
GCCGAGCAGATGGGAAGCCATTTATTGGTGAAGTATGGCCTGGGCCTTGCGTTTTCCCTGACTATACAAATTCCAAAGCA
CGCTCTTGGTGGGCTAATTTGGTTAAGGAGTTTGTTTCAAATGGTGTTGATGGTATATGGAATGATATGAATGAGCCAGC
TGTTTTCAAAGTCGTGACAAAGACGATGCCTGAGAATAATATTCACCGTGGAGATGACGACCTTGGAGGTGTTCAAAACC
ACTCACACTACCACAATGTCTATGGGATGCTGATGGCCAGATCAACTTATGAAGGGATGGAGCTAGCTGATAAGAATAAG
CGACCTTTTGTATTGACAAGAGCTGGATTCATAGGTAGCCAGAGATATGCTGCGACTTGGACAGGAGATAACCTTTCAAA
CTGGGAGCATCTACATATGTCTATATCCATGGTCCTTCAACTGGGGCTTAGTGGTCAGCCCTTATCAGGGCCAGATATCG
GTGGCTTTGCTGGCAATGCAACTCCGCGGCTTTTTGGACGTTGGATGGGTGTTGGAGCTATGTTTCCATTCTGTCGTGGT
CATTCTGAGGCTGGCACTGCTGACCATGAACCATGGTCTTTCGGAGAAGAGTGCGAGGAAGTCTGTCGTGCCGCATTGAA
GAGGCGTTACCAACTCCTACCACATTTTTACACCTTGTTTTACATAGCCCATACAACTGGTGCTCCAGTTGCAGCTCCAA
TCTTTTTCGCTGATCCTAAAGATTCCCGGCTAAGGACTGTTGAAAATGGCTTTCTTTTGGGTCCCCTTCTTTTATATGCA
AGCACTTTGTCTAGTCAGGGATCACATGAGCTGCAGCACATATTGCCCAGAGGAATTTGGCTTAGGTTTGATTTTGAAGA
TTCACATCCGGATTTACCAACATTATATTTACAAGGTGGATCCATCATATCATTGGCTCCTCCACATCTGCATGTTGGGG
AATTTAGTCTGTCAGATGACTTGACCCTACTTGTGTCATTAGATGAAAATGGGAAAGCTAAAGGACTCTTGTTCGAGGAT
GATGGAGATGGATATGGCTACACTAAAGGCAGATTTCTAGTTACACACTACATTGCTGAGCGGCATTCTTCCACTGTCAC
TGTCAAGGTTTCAAAAACTGAAGGAGACTGGCAGAGGCCGAAGCGCCGTATTCATGTCCAATTATTACTAGGAGGCGGTG
CAATGCTTGATGCTTGGGGAATGGATGGAGAGATTATCCACATTAAGGTGCCCTCAGAAAGTGAAGTTTCTGAGTTAATA
TCCACAAGCAATGAGCGCTTTAAACTTCATATGGAAAATACAAAACTGATACCTGAGAAGGAAGTGCTACCTGGACAAAA
GGGAATGGAACTTTCAAAGGAGCCAGTTGAGTTAAACAGTGGCGATTGGAAACTTAATATAGTTCCCTGGATTGGTGGAA
GGATATTGTCTATGACACATGTTCCCTCAGGAATTCAATGGCTTCATAGCAGGATAGATATCAATGGTTATGAGGAGTAT
AGTGGTACTGAGTACCGGTCAGCTGGATGTACTGAGGAATATAATGTCATTGAGAGGGATTTGGAGCATGCAGGAGAGGA
GGAATCTCTGATCCTGGAAGGTGATGTAGGTGGTGGACTGGTTCTTCGGCGTAAAATAAGTATACCTAAAGAAAATCCCC
GAGTTTTTCAGATTGCCTCTAGCATTGAAGCCCGTAGTGTTGGTGCTGGTTCTGGTGGATTTTCAAGGCTAGTATGCTTA
AGAGTCCATCCAACTTTCACTCTTTTGCATCCAACTGAATCGTTTGTCTCATTCATGTCGATTGATGGTTCAAAGCATGA
AGTTTGGCCAGATTCTGAAGAGCAAATATATGAAGGGAACAACCTCCCACATGGTGAATGGATGCTGGTGGACAAGAGCC
TCAATCTACGGCTAGTAAACAAGTTCAATGTTAGTCAGGTCTTCAAATGTATAGTCCACTGGGACTGTGGAACCGTTAAC
TTGGAGCTATGGTCTGAAGACCGACCTGTTTCTAAAGAATCTCCTCTCAAAATAGAGCATGAGTACGAAGTCGCAAGTTT
CCCATAA