Details for Lyrate rockcress Locus 16045363

Position : sca3 ( 5`- 9230671 .. 9229838 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045363

Protein [Map View]
MTKLARKNNTLKASAVISNLTHSTWKKRAKKTICLRRNTQFFVTLCFFGAGGHVSISGILDFLAFGVQQPPPPPPPGDDV
STAGEGEGTE*

DNA
ATGACTAAACTAGCGAGGAAGAACAACACATTAAAAGCATCCGCAGTGATTAGCAACCTAACACATAGCACTTGGAAAAA
AAGAGCAAAGAAAACGATCTGTCTCCGTCGTAACACACAGTTCTTTGTGACCCTTTGCTTCTTCGGCGCCGGTGGACACG
TCAGCATCTCCGGTATCCTAGACTTCTTAGCTTTTGGAGTACAACAACCGCCGCCGCCGCCACCGCCTGGTGACGACGTC
AGCACCGCTGGGGAGGGAGAGGGAACAGAGTAG